KEGG   Pseudomonas mendocina ymp: Pmen_1834Help
Entry
Pmen_1834         CDS       T00510                                 

Definition
(GenBank) PHP C-terminal domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
pmy  Pseudomonas mendocina ymp
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pmen_1834
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Pmen_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ABP84598
UniProt: A4XTD2
Position
2021439..2022350
Genome map
AA seq 303 aa AA seqDB search
MWGIITNINLNESAAMIVDLHCHSTASDGALAPSVLVERAHARGVRVLALTDHDTLEGLD
EAQRTAAALDMQLVNGIELSCTWGGATIHVLGYAFEREAPALRQAIEALHQGRWQRAQEI
DRRLAAKGMPGALDGARAVQQALGDSGNAPARPHFAEFLVRAGHVRDRAEAFRKWLGSGK
LGDVKQHWPVLEDTLATLRAAKAWISLAHPWQYDFTRSKRRRLVADFAAAGGHALEVVNG
MQPAEQVGGLAILAREFGLMASVGSDFHAPGDWSELGMYRPLPDDLTALWERFEHAQPPT
VPS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcataataacaaacatcaatctcaacgaaagcgccgccatgattgtcgatctg
cactgccacagcaccgcctccgatggcgccctggccccgtctgtactggtggagcgggcc
catgcgcgtggcgtgcgagtgctggctctgaccgatcacgacaccctggaagggctcgac
gaggcgcagcgcactgcggcggctctggacatgcaactggtcaacggcatcgagctgtcc
tgcacctggggcggagccaccattcatgtgctggggtatgccttcgagcgcgaagcgccg
gcgctgcgccaggccatcgaggccttgcaccaggggcgctggcagcgcgcgcaggaaatc
gatcgacgcctggctgccaagggcatgcccggcgccctggacggcgcacgggctgtgcag
caggcgctcggcgacagcggcaacgcaccggcgcggccgcatttcgccgaatttctggtg
cgggccgggcatgtacgcgatcgcgccgaggcgtttcgcaagtggttgggctcgggcaag
ctgggcgacgtcaaacagcactggccggtgctggaggacacgctggccaccttgcgtgcg
gccaaggcctggatcagcctggcgcatccctggcagtacgactttactcgcagtaagcgt
cggcgcttggtggccgacttcgccgcggcaggcgggcatgccctggaagtggtcaatggc
atgcaaccggccgagcaggtcggcggtctggcgattctggcgcgtgaattcggcttgatg
gccagcgtcggcagcgatttccatgcgccgggcgactggtccgaactgggcatgtaccgc
ccgttgcctgatgacctgacggcgctctgggagcgcttcgaacatgcacagccacccact
gtcccttcatga

DBGET integrated database retrieval system