KEGG   Pseudomonas mendocina ymp: Pmen_2230
Entry
Pmen_2230         CDS       T00510                                 

Definition
(GenBank) hypothetical protein
Organism
pmy  Pseudomonas mendocina ymp
SSDB
Motif
Pfam: DUF2933 OST3_OST6 DUF3188
Other DBs
NCBI-ProteinID: ABP84989
UniProt: A4XUH3
Position
complement(2463397..2463645)
AA seq 82 aa
MDHTHHTSTTEPPFWKSKIGIALIMLAVIGIFYVAREHYGHLSQALPYLILLLCPLMHLF
GHNHGGHSHSSSTAVSKDEERT
NT seq 249 nt   +upstreamnt  +downstreamnt
gtggaccatacccatcacaccagtaccactgagccgcctttttggaagagcaagattggc
attgcgctgatcatgctggccgtaatcggcatcttctatgtagcgcgtgagcattacggt
catctttcgcaggccctgccgtacctcatcctgctgctatgcccgctgatgcatctgttt
ggccacaatcacggcgggcactcccactccagcagcaccgctgtttccaaggacgaagaa
aggacatag

DBGET integrated database retrieval system