KEGG   Pseudomonas mendocina ymp: Pmen_2318Help
Entry
Pmen_2318         CDS       T00510                                 

Definition
(GenBank) protein of unknown function DUF876
  KO
K11893  type VI secretion system protein ImpJ
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Pmen_2318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmy02044]
    Pmen_2318
Secretion system [BR:pmy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pmen_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ABP85076
UniProt: A4XUR0
Position
complement(2559054..2560388)
Genome map
AA seq 444 aa AA seqDB search
MSWNNRVVWSEGMFLRPQHLQQHDRYLETLVDSRCRPMFAGGWGFSELQLDAALLTQGKL
AILSARGVLPDGTPFDIPGEDVAPTPLIVDPEMRDKLIYLGLPLKRAGTRDTVEEGEALG
GARYISQVREVRDDNAPFESRAPLAIGGKALRLLTERDGLGEYACIGVVRVVEKRADNAL
LLDESYIPPLLDVAASQPLAAFRSELQGLLHQRGEALAGRVVASGAGGASEIADFLLLQL
VNRAEPLISHLARLSPLHPEAFYREAVALAGEFATFSSSGRRPAEYPAYEHDDLAASFAP
VIRELRQALSMVIDSRATPIPIVEKSYGVHVAMLADKNLLQGASFVLVVRADVPAENLRS
LFPQQAKVGSVEHIRDLVNLQLPGIALLPMPVAPRQIPYHAGSSYFELDRGSDHWKQLAN
SGGFAFHIAGQFPGLNLAFWAIRG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggaataaccgagtggtgtggtccgagggaatgttcctgcgcccgcaacacctg
cagcagcatgatcgctacctggaaacgctggtcgacagccgctgccggccgatgttcgcc
ggcggctggggcttctccgaactgcagctggatgcggcgctgctgacccagggcaagctg
gccattctcagcgcccgtggcgtgttgcccgacggaacgcccttcgacatccccggcgag
gacgtggcgccgacgccgctgatcgtcgacccggaaatgcgcgacaagctgatctacctc
ggcctgccgctcaagcgcgccggcacccgcgacaccgtggaggagggcgaagccctcggc
ggcgcccgctacatcagccaggtgcgcgaggtgcgcgacgacaacgcgccgttcgagagc
cgcgcgccgctggccatcggcggcaaggcgctgcgcctgctcaccgagcgcgatggcctc
ggcgagtacgcctgcatcggcgtggtgcgggtggtggaaaagcgtgccgacaacgccttg
ctgctggacgagagttacatcccgccgttgctggacgtcgccgcctcgcagccgctggcg
gcctttcgcagcgaactgcagggcctgctgcatcagcgcggcgaggcattggcgggcagg
gtggtggcctccggtgccggcggcgcctcggaaatcgccgactttctcctgctgcagctg
gtcaaccgcgccgagccgctgatcagccacctggcccggctcagcccgctgcacccggag
gccttctaccgcgaggcggtggcgctggccggcgaattcgccaccttttccagcagcggt
aggcgcccggccgagtacccggcctacgagcacgacgacctggcggccagcttcgccccg
gtgatccgcgagctgcgccaggcgttgtcgatggtcatcgacagccgcgccacgccgatt
cccatcgtcgagaaatcctacggcgtgcacgtggccatgctggccgacaagaacctgctg
cagggcgccagcttcgtcctggtggtgcgcgccgacgtgccggcggagaacctgcgcagc
ctgttcccgcagcaggccaaggtcggctcggtggagcacatccgcgacttggtcaatctg
cagctgccgggcatcgcgctgctgccgatgccggtggcaccacggcagattccctatcac
gccggctccagctacttcgagctggatcgcggcagcgaccattggaagcagttggccaat
tcgggaggcttcgccttccatatcgctggccagttccccggcttgaacctggccttctgg
gccatccgagggtag

DBGET integrated database retrieval system