KEGG   Pseudomonas mendocina ymp: Pmen_2324
Entry
Pmen_2324         CDS       T00510                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy02025  Biofilm formation - Pseudomonas aeruginosa
pmy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pmen_2324
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Pmen_2324
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmy02044]
    Pmen_2324
Secretion system [BR:pmy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pmen_2324
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABP85082
UniProt: A4XUR6
Position
2565959..2566447
AA seq 162 aa
MAVDMFIKIGDLEGESADKTHGKEIDVLAWSWGMSQSGNMHQGGGGGAGKVSIQDISITK
WIDKSSPNLMMACSNGKHFPEAKLTVRKAGGESPVEYLIITLKEVLVSSVSTGGSGGEDR
LTENVSLNFAQVLVDYQPQKADGAKDGGPVKYGWNIRENVKV
NT seq 489 nt   +upstreamnt  +downstreamnt
atggctgttgatatgttcatcaagatcggcgatctggaaggcgaatccgccgacaagacc
cacggaaaggaaatcgacgtactggcatggagctggggcatgtcgcagagcggcaacatg
caccagggcggtggtggcggtgccggcaaggtcagcattcaggacatctcgatcaccaag
tggatcgacaagtcctcacccaacctgatgatggcgtgttccaacggcaagcacttcccg
gaagccaagctgacggtgcgcaaggccggcggcgaatcgccggtggagtacctgatcatc
accctcaaggaagtcctggtgtcctccgtcagcaccggcggcagcggtggcgaggatcgc
ctgaccgagaacgtctcgctcaacttcgcccaggtgctggtcgactaccagccgcagaaa
gccgatggcgccaaggatggaggcccggtcaagtacggctggaacatccgcgagaacgtc
aaggtatga

DBGET integrated database retrieval system