KEGG   Pseudomonas mendocina ymp: Pmen_2332Help
Entry
Pmen_2332         CDS       T00510                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pmen_2332
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmy02044]
    Pmen_2332
Secretion system [BR:pmy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pmen_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C DUF2345
Motif
Other DBs
NCBI-ProteinID: ABP85090
UniProt: A4XUS4
Position
2574325..2576550
Genome map
AA seq 741 aa AA seqDB search
MAITQSTRAVQVNGPLGPNVLLLQGMDGSEELGRPFQYHLELTSEDGSVKFDQLLGKPMG
LSLELPDGGDRYFHGIVCACRQTVGIGQFAGYQVTLRPWLWLLSRTSDCRIFQNKTVPDI
IKQVFRDLGFSDFEDSLSRSYREWEYCVQYRETSFDFVSRLMEQEGIYYYFRHEKARHVL
VLADAYGAHSTVDGYASVPFYPPELQMRERDHFYDWQLAREVQPGSLALTDYDFQRPSAS
LDVRSSVSRSHGNAEYPLFDYPGEYVQSKDGEHYARTRIEAIHTQFERVQLRGRARGLGS
GHLFKLSGYERADQNREYLVVGARYRIRQEAYETGFGDNLEQFTSELDCMDASQAFRPLP
LTPMPIVRGPQTAMVVGPSGEEIWTDQYGRVKVHFYWDRHDQSDENSSCWMRVSQAWAGK
NWGAIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGVKSRSSKEG
TPANFNEIRMEDKKGEEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDNDETVHVKHDRT
ETVDNNETITIGVDRTEKVGNNETITIGVDRTEKVGSNEKISIGNNRTEDVGSDESITIG
ANRTEKVGSNEKISIGNNRTEDVGSDESITIGSNRTEKVGKNEDISIGSNQSTSIGKNES
RSVGQSRDSSIGKDDSLSVGKNFSLNAGDSITLTTGSASITMKKDGTITIRGKNITIDGS
GAINVKASKNVVVKGQKILQN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggccatcacgcaaagcacaagagcggttcaggtcaacggaccactggggcccaacgtc
ctgctgttgcagggcatggatggcagcgaagaactgggccgcccgttccagtaccacctg
gagctgacctcggaagatggctcggtgaagttcgaccagctgctgggcaagcccatgggg
ctgtcgctggagctgcccgatggcggcgatcgttacttccacggcatcgtctgcgcctgc
cgacagaccgtgggcatcggccagttcgccggctatcaggtcaccctgcgaccatggctg
tggctgctgagccggacctccgactgccgcatcttccagaacaagacggtgccggacatc
atcaagcaggtgttccgcgacctgggtttttccgatttcgaagacagcctcagccgcagc
taccgggagtgggagtactgcgtgcagtaccgggaaaccagcttcgatttcgtcagccgg
ctgatggaacaggaaggcatctactactacttccgccacgagaaggcgcgccacgtgttg
gtgctggccgacgcctacggcgcccattcgacggtggacggctacgccagcgtgccgttc
tacccgcccgaactgcagatgcgcgagcgcgaccacttctacgactggcagctggcgcgc
gaggtgcagcccggctccctggcgctgaccgattacgacttccagcgccccagcgccagc
ctcgacgtgcgttccagcgtctcgcgcagccatggcaacgccgaatacccgctgttcgac
tatcccggcgagtatgtgcaaagcaaggacggcgagcactacgcacgcacccgcatcgag
gccatccatacgcagttcgagcgcgtgcagctgcgcggccgtgcccgcggcctgggctcg
ggccatctgttcaagctcagcggttacgagcgcgccgaccagaaccgcgagtacctggtg
gtcggtgcgcgctaccgcatccgccaggaggcctatgagaccggcttcggcgacaacctc
gagcagttcaccagcgagctggactgcatggacgccagccaggcctttcgccccctgccg
ctgacccccatgcccatcgtgcgcgggccgcagaccgccatggtggtcggccccagcggc
gaggagatctggaccgaccagtacggccgggtcaaggtgcacttctactgggaccgccac
gaccagtccgacgagaacagctcctgctggatgcgcgtgtcgcaggcctgggccggcaag
aactggggcgcgatccagattccgcgcatcggccaggaggtgatcgtcagcttcctcgaa
ggcgatccggatcggccgatcatcaccggtcgcgtttacaacgccgagcagacggtgccc
tacgacctgcccgccaacgccacccagagcggcgtgaagagccgttcgagcaaggaaggc
acgccggctaacttcaacgagatccgcatggaggacaagaaaggcgaggagcagctgttc
atccatgcggaaaagaaccaggacatcgaggtcgagaacgacgagacccactgggtcggc
cacgaccgcaccaagaccatcgacaacgacgaaacggtgcacgtcaaacacgaccgtacc
gagacggtggacaacaacgaaaccatcaccatcggtgtggaccgcacggagaaggtcggc
aacaacgagaccatcaccatcggcgtcgatcgcaccgaaaaagtcggcagcaacgagaag
atcagcatcggcaacaaccgcaccgaggatgtcggcagcgacgagagcatcaccatcggc
gccaaccgcaccgagaaggtcggcagcaacgagaagatcagcatcggcaacaaccgcacc
gaggacgtcggcagcgacgagagcatcaccatcggcagcaaccgtaccgagaaggtcggc
aagaacgaagacatcagcatcggcagcaaccagagcaccagcatcggcaagaacgagtcg
cgcagcgtcggtcagagtcgcgacagcagcatcggcaaggacgacagcctgagcgtgggc
aagaacttctccctgaacgcgggcgactccatcaccctgaccaccggctcggccagcatc
accatgaagaaggacggcaccatcaccattcgcggcaagaacatcaccatcgacggctcc
ggggcgatcaacgtcaaggcgagcaagaacgtggtggtcaaggggcagaagattctgcag
aactag

DBGET integrated database retrieval system