KEGG   Pseudomonas mendocina ymp: Pmen_2502Help
Entry
Pmen_2502         CDS       T00510                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00020  Citrate cycle (TCA cycle)
pmy00310  Lysine degradation
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01200  Carbon metabolism
Module
pmy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pmen_2502
  Amino acid metabolism
   00310 Lysine degradation
    Pmen_2502
Enzymes [BR:pmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pmen_2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABP85258
UniProt: A4XV92
Position
complement(2765323..2766555)
Genome map
AA seq 410 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLTEGGAAAAAPAAAPAAAAAPAQAAAPAAAAGDDAILSPAARKLA
EENGIDPNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAAPAKPAAAPAAEAPVIATGDRTE
KRVPMTRLRAKIAERLVEAQSSMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFM
SFFVKAATEALKRFPAVNASIDGNDIVYHGYADIGVAVSSDRGLVVPVLRNAELMSLAEI
ESGIATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRP
MAINGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLEI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgacggcaccgtcgct
acctggcataagaagccgggcgaagcggtcaagcgcgatgagctgatcgtcgacatcgaa
accgacaaggtggtgatcgaagtcctggccgaggccgacggcgtactggctgaaatcatc
aagaacgaaggcgacaccgttctttccaacgaactgctgggcaagctgaccgaaggtggc
gctgccgccgctgctccggctgccgctccggccgctgccgctgctccggctcaggctgcg
gctccggccgccgccgctggtgacgacgccatcctctcgccggccgcgcgcaagctggcc
gaagagaacggcatcgacccgaacagcatcgccggcaccggcaagggcggccgtgtgacc
aaggaagacgtggtcgctgccgtcgaagccaagaagaacgctccggctgccgcaccggcc
aagccggccgctgctcctgccgcagaagctccggtaatcgccaccggcgaccgtaccgag
aagcgcgtgccgatgacccgcctgcgtgccaagatcgccgagcgtctggtcgaggctcag
tcctccatggccatgctgaccaccttcaacgaagtggacatgaccgaagtcatggccctg
cgttcgaagtacaaggacctgttcgagaagtcccacaatggcgtgcgcctgggcttcatg
tcgttcttcgtcaaggccgctaccgaggcgctgaagcgcttcccggcagtcaacgcctcg
atcgacggcaacgacatcgtttaccacggctatgccgacatcggtgttgccgtgtccagc
gaccgtggcctggtggttccggtgctgcgcaacgccgagctgatgagcctggctgaaatc
gagagcggcattgccaccttcggcaagaaggcgcgcgacggcaagctgtcgatcgaagaa
atgactggcggtaccttcaccatcaccaacggcggtactttcggttcgatgatgtcgact
ccgatcgtcaacccgccgcaggccgcgatcctgggtatgcacaacatcatccagcgcccg
atggcgatcaatggtcaggtggtgatccgtccgatgatgtatctggcgctgtcttacgat
caccgcctgatcgatggtaaggaagccgtgaccttcctggtgaccatcaagaacttgctt
gaagatccggctcgcctgctgctggaaatctaa

DBGET integrated database retrieval system