KEGG   Pseudomonas mendocina ymp: Pmen_2590Help
Entry
Pmen_2590         CDS       T00510                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00071  Fatty acid degradation
pmy00280  Valine, leucine and isoleucine degradation
pmy00281  Geraniol degradation
pmy00310  Lysine degradation
pmy00362  Benzoate degradation
pmy00380  Tryptophan metabolism
pmy00410  beta-Alanine metabolism
pmy00640  Propanoate metabolism
pmy00650  Butanoate metabolism
pmy00903  Limonene and pinene degradation
pmy00930  Caprolactam degradation
pmy01040  Biosynthesis of unsaturated fatty acids
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01200  Carbon metabolism
pmy01212  Fatty acid metabolism
Module
pmy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pmen_2590
   00650 Butanoate metabolism
    Pmen_2590
  Lipid metabolism
   00071 Fatty acid degradation
    Pmen_2590
   01040 Biosynthesis of unsaturated fatty acids
    Pmen_2590
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pmen_2590
   00310 Lysine degradation
    Pmen_2590
   00380 Tryptophan metabolism
    Pmen_2590
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pmen_2590
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pmen_2590
   00281 Geraniol degradation
    Pmen_2590
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pmen_2590
   00930 Caprolactam degradation
    Pmen_2590
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pmen_2590
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pmen_2590
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pmen_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 PALP 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N F420_oxidored DUF4034
Motif
Other DBs
NCBI-ProteinID: ABP85346
UniProt: A4XVI0
Position
complement(2853047..2855191)
Genome map
AA seq 714 aa AA seqDB search
MTDAIRYEKGQDNIVVLTMDMPGQSANTMNAVYREAMGLIVDRLEAERDSIAGVIVTSAK
KTFFAGGDLNELIKVTQAEAQGFYEMILRIKGQLRRLETLGKPVVAAINGAALGGGWEIA
LACHHRIALNESHVQLGLPEVTLGLLPGGGGVVRMVRLLGLEKALPYLAEGKKVRPDAAL
KAGLIHDLASDREEMLAKARAWIAANPAAKQPWDVQGYKIPGGTPSSPNVAQMLAIAPSV
LRDKTKGCFPAPEKILCAAVEGAQVDFDTAQIIEARYFTELTCGQVAKNMIGTFWFQLNE
INAGGSRPQGYPKTQTKKVGVLGAGMMGAGIAYVSAAAGIEVVLKDVSVEAAEKGKAYSA
KLLDKKVGKGHMSGEQRDAFLARIKATDSEADFAGCDLIIEAVFEDRALKGKVTAAAEAA
ALSDAVIASNTSTLPITGLATAVAKPEKFIGLHFFSPVDKMQLVEIVRGEQTSDETLARG
FDYVMQIKKTPIVVNDSRGFFTSRVFGTFTNEGLAMLGEGVSAAMIENEARKAGMPVGPL
AISDEVSMSLMNHIRQQTIKDLAAEGKSIPEHPAFAVIDLMLNEYKRPGKAAGMGFYDYP
AGGKKHLWPELKARFEKADAQISQEDVRDRILFIQAIETVRCVEEGVLKSVADANIGSIF
GIGFAAWTGGALQFINQYGVKDFVARAQYLAEQYGERFLPPARLLEKAAKGETF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgccatccgttacgaaaagggccaggacaatatcgtcgtcctgaccatggac
atgcccggccagagcgccaacaccatgaacgcggtctaccgcgaggccatgggtctgatc
gtcgatcgtctggaagcggaaagggattcgatcgccggggtgatcgtcacctcggcgaag
aaaaccttcttcgccggtggtgacctcaacgaactgatcaaggtcacccaggccgaggcc
cagggcttctacgagatgatcctcaggatcaagggccagttgcgccgtctggaaaccctc
ggcaaacctgtggtcgccgccatcaacggagcagcgctgggcggcggctgggaaatcgcc
ctggcctgtcaccaccgcatcgcgctaaacgaaagccacgtgcagctcggcctgccggag
gtcaccctcggcctgctgccgggcggcggcggggtggtgcgcatggtgcgcctgcttggt
ctggaaaaggcgctgccgtatctggccgaaggcaagaaggtacgcccggacgctgcgctc
aaggccggcctgattcacgatctggccagcgaccgcgaggagatgctggccaaggcccgc
gcctggatcgccgccaacccggcggccaagcagccgtgggacgtgcagggctacaagatt
cctggcggcacgcccagttcgccgaacgtggcgcagatgctggccatcgccccgagcgtg
ctgcgcgacaagaccaagggctgcttcccggcgccggagaagatcctgtgcgccgctgtg
gaaggtgcgcaggtcgacttcgacaccgcgcagatcatcgaggcgcgctacttcaccgag
ctgacctgcggtcaggtggcgaagaacatgatcggcaccttctggttccagctcaatgag
atcaacgctggcggctcgcgcccgcagggctacccgaaaacccagacgaagaaggtcggc
gtgctcggtgccggcatgatgggtgccggtatcgcctacgtatcggcagcggccggcatc
gaggtggtgctcaaggatgtgtccgtcgaagcggcggagaagggcaaggcctactcggcc
aagctgctggacaagaaagtcggcaagggccatatgagtggcgagcaacgcgacgccttc
ctggcgcggatcaaggccaccgatagcgaggcggatttcgccggctgcgatctgatcatc
gaagccgtattcgaggaccgtgcgctcaagggcaaggtcaccgctgccgccgaggccgcg
gcgctgagcgatgcggtgatcgcctccaacacctcgacgctgccgatcaccggtctggcg
actgccgtggcaaaaccggagaaattcatcggcctgcatttcttcagtccggtggacaag
atgcagctggtggagattgtccgcggcgagcaaacctcggatgagaccctggcgcgtggc
ttcgactacgtcatgcagatcaaaaagacccccatcgtggtcaacgacagccgcggcttc
ttcacctcgcgcgtgttcggcaccttcaccaacgaaggcctggccatgcttggcgaaggc
gtcagcgccgcgatgatcgagaacgaggcgcgcaaggccggcatgccggtcggcccgctg
gcgatcagcgacgaagtgtcgatgagcctgatgaaccatatccgccagcagaccatcaag
gacctggccgccgagggcaaatccatccccgagcatccggcctttgctgtcatcgatctg
atgcttaacgagtacaagcgtccgggcaaagcggcgggcatgggcttctacgattacccg
gccgggggcaagaagcacctgtggccggagctcaaggcacgtttcgaaaaggccgatgca
cagatctcgcaggaggacgtgcgcgaccgcattctgttcatccaggccatcgagacggtg
cgctgcgtggaagagggcgtgctgaagtcggtggccgacgccaatatcggctcgatcttc
ggcatcggcttcgccgcctggaccggcggtgcgctgcagtttatcaatcagtacggggtg
aaagacttcgtcgcgcgggcccagtacctggccgaacagtacggcgagcgcttcctgcca
ccggcgcggttgctggagaaggcggccaagggcgaaaccttctga

DBGET integrated database retrieval system