KEGG   Pseudomonas mendocina ymp: Pmen_2591Help
Entry
Pmen_2591         CDS       T00510                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00071  Fatty acid degradation
pmy00072  Synthesis and degradation of ketone bodies
pmy00280  Valine, leucine and isoleucine degradation
pmy00310  Lysine degradation
pmy00362  Benzoate degradation
pmy00380  Tryptophan metabolism
pmy00620  Pyruvate metabolism
pmy00630  Glyoxylate and dicarboxylate metabolism
pmy00640  Propanoate metabolism
pmy00650  Butanoate metabolism
pmy00900  Terpenoid backbone biosynthesis
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01200  Carbon metabolism
pmy01212  Fatty acid metabolism
pmy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pmen_2591
   00630 Glyoxylate and dicarboxylate metabolism
    Pmen_2591
   00640 Propanoate metabolism
    Pmen_2591
   00650 Butanoate metabolism
    Pmen_2591
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pmen_2591
   00072 Synthesis and degradation of ketone bodies
    Pmen_2591
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pmen_2591
   00310 Lysine degradation
    Pmen_2591
   00380 Tryptophan metabolism
    Pmen_2591
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pmen_2591
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pmen_2591
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pmen_2591
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmy04147]
    Pmen_2591
Enzymes [BR:pmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pmen_2591
Exosome [BR:pmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pmen_2591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: ABP85347
UniProt: A4XVI1
Position
complement(2855353..2856558)
Genome map
AA seq 401 aa AA seqDB search
MTEAYIFDAVRTPRGKGKKDGALYSVKPVQLVAGLLNALQARNDLDTSQVDDIVLGCVTP
VGDQGADIAKTAAMVADWDVSVAGVQLNRFCASGLEAVNMGAMKVRSGFEDLVVVGGVES
MSRVPMGSDGGAWVMDPETNIHTNFVPQGIGADLIATLEGFSRADVDAFALRSQQKAARA
SADGSFARSLVPVTDQNGIVLLDHDEFIRGDSTLEGLGKLKPSFEMMGQMGFDATALRVY
SHVERIDHVHTPGNSSGIVDGAALMLIGSEAKGKELGLKPRARIVATAVTSTDPTIMLTG
PAPATRKALAKAGLSIDDIDLFEVNEAFASVVMKFMKDMGVSEDKVNVNGGSIAMGHPLG
ATGCASLGTLLDELEKRQLRYGLATLCVGGGMGIATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcatatattttcgatgcggtacgcacaccgcgcggcaagggcaagaaggac
ggcgcgctgtacagcgtcaagccggtgcaactggtcgccggcctgttgaacgccttgcag
gcccgcaacgacctggataccagccaggtggacgacatcgtgttgggctgcgtgacgccc
gtgggcgatcagggcgccgatatcgccaagaccgccgccatggttgcggactgggatgtc
agcgtcgccggtgtgcagctcaaccgcttctgcgcctcgggcctggaggcggtgaacatg
ggcgccatgaaggtgcgctccggcttcgaggatctggtggtggtcggtggcgtggagtcc
atgtcgcgcgtgcccatgggctctgacggcggcgcctgggtgatggacccggaaaccaac
atccacaccaatttcgtcccgcagggcatcggtgccgacctgatcgccaccctggagggt
ttcagtcgcgccgatgtcgatgccttcgccctgcgctcgcagcagaaggccgcgcgcgcc
agcgccgatggttcgttcgccaggtcgctggtgccggtgaccgatcagaacggcatcgtg
ctgctggatcatgacgagttcattcgcggcgactccaccctcgaaggtttgggcaagctc
aagcccagcttcgagatgatgggccagatgggcttcgacgccaccgcgctgcgcgtctac
agccatgtcgagcgcattgaccatgtgcatacgccgggcaacagctccggcatcgtcgac
ggcgcggcgctgatgctgatcggctccgaagccaagggcaaggagctgggcctgaaaccg
cgcgcgcgcatcgtcgccacggcggtgaccagcaccgacccgaccatcatgctcaccggc
ccggcgccggccacgcgcaaggcactggccaaggcggggctgtccatcgacgacatcgac
ctgttcgaggtcaacgaggccttcgcctcggtggtgatgaagttcatgaaggacatgggc
gtgagcgaggacaaggtcaacgtcaatggcggttccattgccatgggccacccgctgggc
gccaccggctgcgccagcctcggcacgctgctcgacgaactggaaaaacgccagttgcgc
tacggtctggccacgctctgcgtaggcggcggtatgggtatagccaccatcatcgaacgt
atctaa

DBGET integrated database retrieval system