KEGG   Pseudomonas mendocina ymp: Pmen_3047Help
Entry
Pmen_3047         CDS       T00510                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00900  Terpenoid backbone biosynthesis
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pmen_3047
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Pmen_3047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABP85801
UniProt: A4XWT5
Position
complement(3374131..3375315)
Genome map
AA seq 394 aa AA seqDB search
MSTVQQITVLGATGSIGLSTLDVIARHPERYAVFALSGFSRLAELETLCVQHRPRYVVVP
DAAAAHALQGSLRAAALPTEVLVGEEGLCAVAGHGEVDCVMAAIVGAAGLRPTLAAVQAG
KKVLLANKEALVMSGALFMQAVRESGATLLPIDSEHNAIFQCLPGDYGRGLQAVGVRRVL
LTASGGPFRETPLAELERVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAR
PEQIEVVIHRQSVIHSLVDYVDGSVLAQLGNPDMRTPIAHALAWPQRIDSGVSPLDLFAI
GRLDFERPDEQRFPCLRLAREAAQVGGSAPAMLNAANEVAVDAFLQRRIRFSDIARMIEF
VLNAESARAVEALDAVFEADRRARALAGEWLARH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacagtgcagcagatcaccgtactgggggcgaccggctccatcggtctgagcacc
ctggacgtgatcgcgcgtcaccccgagcgttacgcggtattcgcgctcagcggcttttcc
cggctggcggagctggagacgctctgcgtacagcatcgtccgcgctatgtcgtggtgccc
gacgctgccgcggcgcacgctctgcagggcagcctgcgagcggcggcgttgcccaccgag
gtgctggtgggcgaggagggcctgtgcgccgtggctggacatggcgaggtcgactgcgta
atggcggcgatcgtcggtgccgccggcctgaggccgaccctggcggcggtgcaggccggc
aagaaagtgctgctggccaacaaggaggcgttggtgatgtccggcgccctgtttatgcag
gcggtgcgcgagagtggcgccaccttgctgccgatcgatagcgagcacaacgccattttc
cagtgtctgccgggcgactacggccgcgggctgcaggcggtcggcgtgcgtcgggtgctg
ctcaccgcttccggcggtccctttcgcgaaacgccgctggccgagctggagcgtgtcacg
cccgagcaggcctgtgcacatcccaactggtcgatggggcgcaagatctccgtggactcg
gcgagcatgatgaacaaggggctggagctgatcgaagcctgctggctgttcgatgcgcgt
cccgagcagatcgaggtggtcatccatcggcagagcgtgattcattcgctggtcgattac
gtcgacggttcggtgctggcgcagttgggcaacccggacatgcgcacgcccatcgcccat
gccctggcctggccgcagcgtatcgattcgggggtgtcgcccctggatctgtttgccatc
ggtcgcctggatttcgagcgccccgacgagcagcgctttccctgtcttcgcctggcgcgc
gaggcggcgcaggtcggcggcagcgctccggcgatgctcaacgcggccaacgaggtcgcg
gtcgacgcctttctgcagcgccgcatccgcttcagcgatatcgcgcgtatgattgagttc
gtgttgaacgcggagtcggcgcgggcagtcgaagcgctcgatgcggtcttcgaggccgat
cgccgggcgcgcgccctggctggtgaatggctcgcccggcattga

DBGET integrated database retrieval system