KEGG   Pseudomonas mendocina ymp: Pmen_3109Help
Entry
Pmen_3109         CDS       T00510                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00010  Glycolysis / Gluconeogenesis
pmy00620  Pyruvate metabolism
pmy00640  Propanoate metabolism
pmy00680  Methane metabolism
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmen_3109
   00620 Pyruvate metabolism
    Pmen_3109
   00640 Propanoate metabolism
    Pmen_3109
  Energy metabolism
   00680 Methane metabolism
    Pmen_3109
Enzymes [BR:pmy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pmen_3109
Lipid biosynthesis proteins [BR:pmy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pmen_3109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABP85862
UniProt: A4XWZ6
Position
complement(3434745..3436706)
Genome map
AA seq 653 aa AA seqDB search
MSAASIYPVSPEAAARTLTDEATYKAMYQQSVVNPEGFWREQGKRIDWIKPYTKVKQTSF
DDHHVDIKWFADGTLNVSYNCLDRHLEERGDQIAIIWEGDDPAEHKEITYRELHEQVCKF
ANALRGQDIHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCQS
KVVITADEGVRGGKKVALKANVDDALTNPETHSVQKVIVVQRTGSEIKWNQHRDIWYEDL
MKVAGSVCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYASLTHERVFDYRPGEV
FWCTADIGWVTGHSYLVYGPLANGATTVMFEGVPNYPDVTRVAKIVDKHKVNILYTAPTA
IRAMMAEGKAAVAGADGSSLRLLGSVGEPINPEAWQWYYENVGQSRCPIVDTWWQTETGA
CLMTPLPGAHAMKPGSAARPFFGVQPALVDNLGNIIEGPAEGNLVIIDSWPGQARTLFGD
HDRFVDTYFKTFKGMYFTGDGARRDEDGYWWITGRVDDVLNVSGHRMGTAEIESAMVAHP
KVAEAAVVGVPHDIKGQGIYVYVTLNAGEESSEQLRQELRNWVRKEIGPIATPDVIQWAP
GLPKTRSGKIMRRILRKIATAEYEALGDISTLADPGVVQHLIDTHRQMQAACA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgcgtctatctatcccgtgagcccggaagcggccgccaggaccctgaccgat
gaggccacctacaaggccatgtatcagcagtcggtcgtcaacccggaaggattctggcgc
gagcaaggcaagcgcatcgactggatcaagccctacaccaaggtcaagcagacttccttc
gacgatcaccacgtcgacatcaagtggtttgccgatggcaccctgaacgtctcctacaac
tgcctggaccgtcatctggaagagcgcggcgatcagatcgcgatcatctgggaaggtgac
gaccccgccgagcacaaggagatcacctaccgcgagctgcacgagcaggtgtgcaagttc
gccaacgccctgcgcggccaggacattcaccgcggcgacgtggtgaccatctacatgccg
atgatccccgaggccgtggtggccatgctggcctgcgcccgtatcggcgccattcactcg
gtggtgttcggcggcttctctccggaagcgttggcgggccgtatcatcgactgccagtcc
aaggtggtgatcaccgccgacgaaggcgtgcgtggcggcaagaaggtggccttgaaggcc
aacgtcgacgacgcgctgaccaacccggaaacccacagcgtgcagaaggtcatcgtggtc
cagcgcaccgggtccgagatcaagtggaaccagcatcgcgacatctggtacgaagacctg
atgaaggtggccggcagcgtctgcgcgccgaaggaaatgggcgccgaggaagcgctgttc
atcctctacacctccggttccaccggcaagcccaagggcgtgctgcacaccaccggcggc
tacctggtatacgcctcgctgacccatgagcgggtgttcgactaccgtccgggcgaggtc
ttctggtgcaccgccgacatcggctgggtcaccggtcacagctacctggtctacggcccg
ctggccaacggtgccaccaccgtgatgttcgagggcgtgccgaactacccggacgtgacc
cgcgtcgccaagatcgtcgacaagcacaaggtcaacatcctctacaccgcaccgaccgcc
attcgcgccatgatggccgagggcaaggctgcagtagccggtgccgatggctccagcctg
cgcctgctgggttcggtcggcgagccgatcaacccggaagcctggcagtggtactacgag
aacgtcggccagagccgttgcccgatcgtcgacacctggtggcagaccgaaaccggcgcc
tgcctgatgaccccgctgccgggcgcgcacgccatgaagccgggctccgccgcgcgtccg
ttcttcggcgtgcagccggcactggtggacaacctgggcaacatcatcgaagggccggcc
gaaggcaacctggtgatcatcgattcctggccgggtcaggcgcgcaccctgttcggcgac
cacgaccgcttcgtcgacacctacttcaagaccttcaagggcatgtacttcaccggtgac
ggcgcgcgccgcgacgaagacggctactggtggatcaccggtcgcgtcgacgacgtgctc
aacgtttccggccaccgtatgggcaccgccgagatcgagagcgccatggtcgcccacccg
aaagtggccgaggccgcggtggtcggcgtgccgcacgacatcaaggggcagggcatctac
gtctacgtgaccctgaacgcgggcgaggaatcctccgagcaactgcgtcaggaactgagg
aactgggtgcgcaaggaaatcggtccgatcgccacaccggacgtgatccagtgggcgccg
ggcctgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccacc
gccgaatacgaggcactcggcgacatctccacgctggccgatcctggcgtggtgcagcac
ctcatcgatacgcatcgtcagatgcaagccgcctgcgcctga

DBGET integrated database retrieval system