KEGG   Pseudomonas mendocina ymp: Pmen_4126Help
Entry
Pmen_4126         CDS       T00510                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00625  Chloroalkane and chloroalkene degradation
pmy00680  Methane metabolism
pmy01100  Metabolic pathways
pmy01120  Microbial metabolism in diverse environments
pmy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Pmen_4126
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pmen_4126
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Pmen_4126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABP86873
UniProt: A4XZV7
Position
complement(4523782..4524981)
Genome map
AA seq 399 aa AA seqDB search
MSDNRGVVYLGAGKVEVQKIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTA
QVGLVLGHEITGEVIEKGRDVERLQIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDLNPARLAHAKAQGFEIADLSLD
TPLHEQIAALLGEPEVDCAIDCVGFEARGHGHEGAKHEAPATVLNSLMQVTRVAGKIGIP
GLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSFHTGQTPVMKYNRALMQAIMWDRLNIA
EIVGVQVISLDDAPRGYGEFDAGVPKKFVIDPHKMFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataatcgtggtgtggtttacctcggcgcgggcaaggtcgaagtgcagaagatc
gactacccgaaaatgcaggacccgcgtggtaagaagatcgagcacggggtcatcctgaaa
gtcgtttccaccaatatctgcggctccgaccagcacatggtgcgaggtcgtaccaccgct
caggtcggcctggttctgggccacgagatcaccggcgaggtgatcgagaagggccgcgac
gtcgagcgtctgcagatcggtgacctggtttcggtgcccttcaacgtcgcctgcggtcgc
tgccgcagctgcaaggaacagcacactggcgtctgcttgaccgtcaacccggcgcgtgcc
ggcggtgcctacggctacgtcgacatgggcgactggaccggtggccaggccgaatacgtg
ctggtgccctacgccgacttcaacctgctcaagctgccggatcgcgacaaggccatggag
aagatccgcgacctgacctgcctgtccgacattctgcccaccggctaccacggcgcggtc
accgccggcgtcggcccgggctccaccgtctacgtcgccggtgccggcccggtcggtctg
gctgccgccgcctcggcgcgtctgctcggcgctgccgtggtcatcgtcggtgacctcaac
ccggcccgtctggcccatgccaaggcgcagggcttcgagatcgccgacctgtcgctggat
acgccgctgcacgagcagatcgccgcgctgctgggcgagccggaagtcgattgcgccatc
gactgcgtgggcttcgaggcccgtggtcatggtcacgaaggtgccaagcacgaggccccg
gccaccgtgctcaactcactgatgcaggtcacccgcgtcgccggcaagatcggcatcccc
ggtctgtacgtcaccgaagacccgggcgcggtggacgccgcggcgaagatcggcagcctg
agcatccgcttcggcctcggctgggccaagtcgcacagcttccacaccggccagaccccg
gtgatgaagtacaaccgcgcgctgatgcaggccatcatgtgggatcgcctcaacatcgcg
gagatcgtcggcgtacaggtcatcagcctggacgacgcaccgcgcggttacggcgagttc
gacgcaggcgtgccgaagaaattcgtcatcgacccgcacaagatgttcagcgctgcctga

DBGET integrated database retrieval system