KEGG   Pseudomonas mendocina ymp: Pmen_4209Help
Entry
Pmen_4209         CDS       T00510                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00670  One carbon pool by folate
pmy00790  Folate biosynthesis
pmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pmen_4209
   00670 One carbon pool by folate
    Pmen_4209
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Pmen_4209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 SmpB
Motif
Other DBs
NCBI-ProteinID: ABP86956
UniProt: A4Y040
Position
complement(4613199..4613729)
Genome map
AA seq 176 aa AA seqDB search
MLAAMKTTLPLSLIAALADNRVIGRDNQLPWHLPADLKHFKALTLGKPIIMGRKTWDSLG
RPLPGRLNIVVSRQAGLTLEGAEVFATLEEAIKRADAWAREEDAEELMLIGGAQLYELGL
EQADRLYLTRVGLEPEGDAFFPQIDESAWRMTSSVEHPASAETPFYAFEVWERRGA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggccatgaaaacgacactgcccctttccctgatcgccgccctcgccgacaac
cgcgtgatcggtcgcgacaaccaactgccctggcacctgccggcggacctcaagcacttc
aaggcgctgacgctcggcaagccgattatcatggggcgcaagacctgggattcgctcggt
cggccgctgccggggcggctcaacatcgtggtcagccgccaggcaggcctgactctggaa
ggcgccgaggtattcgcgacgctggaagaggccatcaaacgagccgacgcctgggcgcgt
gaagaggatgccgaggaactgatgctgatcggcggcgcgcagctctatgagctgggcctg
gaacaggccgatcgcctgtatctgacccgggtcggtctcgagcctgagggtgatgcgttc
tttccgcaaatcgacgagtcggcctggcgcatgacctccagcgtcgagcatccggcctcc
gccgagacgcccttctacgccttcgaagtgtgggaacggcgcggcgcataa

DBGET integrated database retrieval system