KEGG   Pseudomonas mendocina ymp: Pmen_4623Help
Entry
Pmen_4623         CDS       T00510                                 

Definition
(GenBank) LSU ribosomal protein L34P
  KO
K02914  large subunit ribosomal protein L34
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy03010  Ribosome
Module
pmy_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Pmen_4623
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pmy03011]
    Pmen_4623
Ribosome [BR:pmy03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Pmen_4623
  Bacteria
    Pmen_4623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L34
Motif
Other DBs
NCBI-ProteinID: ABP87369
UniProt: A4Y1A3
Position
complement(5072230..5072364)
Genome map
AA seq 44 aa AA seqDB search
MKRTFQPSTIKRARTHGFRARMATKNGRAVLSRRRAKGRKRLTV
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcactttccaacccagcaccatcaagcgcgctcgtacccacggtttccgtgcc
cgcatggccaccaagaacggccgtgccgtcctgtcgcgtcgtcgcgccaagggccgcaag
cgtctgactgtctaa

DBGET integrated database retrieval system