KEGG   Prevotella melaninogenica: HMPREF0659_A5212Help
Entry
HMPREF0659_A5212  CDS       T01286                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
pmz  Prevotella melaninogenica
Pathway
pmz00471  D-Glutamine and D-glutamate metabolism
pmz00550  Peptidoglycan biosynthesis
pmz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    HMPREF0659_A5212 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0659_A5212 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmz01011]
    HMPREF0659_A5212 (murD)
Enzymes [BR:pmz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     HMPREF0659_A5212 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:pmz01011]
 Precursor biosynthesis
  Amino acid ligase
   HMPREF0659_A5212 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADK96317
UniProt: D9RRH2
Position
I:complement(304820..306151)
Genome map
AA seq 443 aa AA seqDB search
MKRIVILGAGESGAGAAVLAKKEGFDVFVSDMSAIKDKYKKMLDDRGIEWEEGQHTEEKI
LNADEIIKSPGIPKEAPMVQKLIAQGTHIISEIEFAGRYTNSKMICITGSNGKTTTTSLI
YHIFKDAGYDAGLAGNIGNSLALQVAEDPHEYYIIELSSFQLDNMYDFRANIAILLNITP
DHLDRYDYKFENYADAKMRIIQNQTKEDSFIYWNDDPVIKKELEKFDVHAVCYPFSELKE
KGSIGYIEEGQYTIEQPEPFNMEQEDLSLTGRHNIYNSLAAGIASDISGIKKENIRKSLS
DFPGVEHRLEKVCKVAGVQYINDSKATNVDACWYALESMRTPTILIIGGKDKGNDYNSIK
DLVKQKCAGIVYLGADNKKLHDNFDDLGLPIRDTHSMKDCVAACAELAKPGDTVLLSPCC
ASFDLFKNMEDRGEQFKSYVRAL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagtaatacttggtgccggtgaaagtggtgccggcgcagcagtattggca
aagaaagaaggcttcgatgtctttgtttctgacatgtcagccattaaggacaagtataag
aagatgcttgatgaccgtggtatagaatgggaagagggacaacacacagaagagaagatt
ctcaatgctgatgaaatcatcaagagtcctggtattcctaaagaagctcctatggttcag
aaacttatcgcacagggtacacatatcattagtgaaatagaatttgctggtcgatacacc
aactctaagatgatatgtattactggaagtaatggaaagaccacaacaacgagcctcatc
tatcatatcttcaaagatgctggttacgacgctggtttggctggtaacattggtaacagt
cttgcactgcaagtagcagaagacccacatgagtattatatcattgagttgagcagcttc
cagttggacaatatgtatgacttccgtgccaatattgccatccttctcaatatcacccct
gaccacttggaccgctatgactacaagtttgagaactacgcagacgctaagatgcgtatc
attcagaatcaaaccaaggaggatagcttcatttactggaacgatgaccctgtcatcaag
aaggaactcgagaagtttgatgtacatgccgtatgctatccattctctgaattaaaggag
aaaggcagtatcggttacattgaagaaggacagtatacgattgaacagcctgagccattc
aacatggaacaggaagacctttcgctcacaggacgtcacaacatctacaactctttggca
gcaggtattgcctcagacattagcggtattaagaaagaaaacatccgtaagagtctgagc
gacttccctggcgttgaacatagattggaaaaggtatgtaaggttgctggcgtacaatac
atcaacgactctaaggctaccaatgttgacgcttgttggtatgcacttgaaagcatgcgc
acaccaacaatcttgattattggtggcaaggataagggaaatgactataacagcattaag
gacttagttaagcagaagtgtgctggaattgtctaccttggagctgacaataagaagcta
catgacaacttcgacgaccttggtcttcctatccgcgacacccattccatgaaggattgt
gttgcagcttgtgcagagttagcaaagcctggtgacacagttctcctaagcccatgctgt
gcaagcttcgatctttttaagaatatggaagaccgtggcgagcagttcaagagctatgta
agagcattgtag

DBGET integrated database retrieval system