KEGG   Prevotella melaninogenica: HMPREF0659_A6609Help
Entry
HMPREF0659_A6609  CDS       T01286                                 

Definition
(GenBank) putative glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pmz  Prevotella melaninogenica
Pathway
pmz00010  Glycolysis / Gluconeogenesis
pmz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0659_A6609
Enzymes [BR:pmz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     HMPREF0659_A6609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2 IL2
Motif
Other DBs
NCBI-ProteinID: ADK97122
UniProt: D9RVC8
Position
II:complement(262378..263667)
Genome map
AA seq 429 aa AA seqDB search
MRKLNSLLLLLILTIICPALAQAQLQRSEAFKGKYKLKEVVILSRHNIRSPLSTNGSALS
KMTPHEWTNWSSAASELTLRGGVLETEMGQFFRKWTIETGLFKDNYVPTIDEVNVYANSM
QRCIATAQYFSGGFMPVANLRVNHRYVPSKMDPIFFPRLTKSTEAFRTEAMKQINAMGGK
EGLVGINKSLKESYDLIAKVLDIKQSEYYKKGEIKDFVNNDTQITLELNQEPGMKGSLKN
ANSASDAFILQYYEEPDGMKAAFGHKLTTEDWTKIAKVKDVYGDVLFTAPIVAVNVAHPL
LQYMYDELNDKDRKFTFLCGHDSNIASVDAALGVEDYSLPNSIEKKTPIGSKLVLEKWVD
AAGKAYIAVNLVYQSTDQLKQMSLLDLQHAPQVFSLKLKGLNQNTDGLYTFEDVNARFLQ
AIRAYDDIK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacttaattcactcttactccttttaatactgacaatcatttgtccagcatta
gcacaggcacagcttcagcgttctgaggcgttcaaaggaaaatacaaactaaaggaagtt
gttattctctctcgtcataacatccgctcaccactatcaaccaatggttctgcactgagc
aagatgactccacacgagtggacaaattggtcatctgcagccagcgaactgacactcaga
ggtggtgtacttgaaaccgagatgggacagttcttccgcaaatggactatcgaaacggga
ttgtttaaggataactatgttccaacaattgacgaagtaaatgtctatgccaactctatg
cagcgttgtatcgctactgcacaatacttctctggtggcttcatgccagtggctaaccta
cgtgtgaaccaccgctatgtaccatctaagatggacccaatcttcttccctcgtcttaca
aagagtactgaggctttccgcactgaggctatgaagcaaatcaatgctatgggtggtaag
gaagggcttgttggtatcaacaaaagtctaaaggagagctacgacctcattgctaaggtc
ttagacataaagcaaagtgagtattataagaaaggagaaataaaagacttcgttaataac
gatacacaaattacgcttgaactcaaccaagagccaggaatgaagggttcgttgaagaat
gctaactctgcttctgacgcctttatcctccagtattatgaggagccagatggcatgaaa
gctgcctttggtcataaactcacaactgaggattggactaagattgctaaggtaaaagac
gtgtatggcgacgtacttttcactgctccgatcgttgctgttaacgtggctcacccactt
ttgcagtatatgtatgacgaactgaacgacaaagatcgtaagtttacattcctctgtggt
catgactcaaacattgcaagtgttgatgctgcccttggtgttgaggactattcacttcct
aactctatcgagaagaagactcctatcggttcaaaacttgtcttagagaagtgggtcgac
gctgctggtaaagcttatatagccgtaaaccttgtttatcagagtacagaccaacttaag
cagatgtccctactcgacctgcagcatgctccacaagtattctccttaaagttgaagggt
ctcaatcagaatactgacggtctttatactttcgaggatgtcaatgcacgtttccttcag
gctattcgcgcatacgatgatattaagtaa

DBGET integrated database retrieval system