KEGG   Prevotella melaninogenica: HMPREF0659_A7219Help
Entry
HMPREF0659_A7219  CDS       T01286                                 

Definition
(GenBank) penicillin-binding protein, transpeptidase domain protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pmz  Prevotella melaninogenica
Pathway
pmz00550  Peptidoglycan biosynthesis
pmz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pmz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0659_A7219
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HMPREF0659_A7219
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmz01011]
    HMPREF0659_A7219
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmz03036]
    HMPREF0659_A7219
Enzymes [BR:pmz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HMPREF0659_A7219
Peptidoglycan biosynthesis and degradation proteins [BR:pmz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   HMPREF0659_A7219
Chromosome and associated proteins [BR:pmz03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    HMPREF0659_A7219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ADK96565
UniProt: D9RX15
Position
II:1080121..1081110
Genome map
AA seq 329 aa AA seqDB search
MSILFFANQGYAQQINSHLQAKSTLQNHVSSILKENIKKIDAINGQIIIMDCKSGEIKAM
VNLMNTKSGIKPAIRQLSEPTALMRTVSLLAVLEQGKVNLNDSIDTKAGMLDINGYLLKD
YNWLRGGNGKTSVQQGFLLSSNIATYLTVKQAFGKEYDRFYKAITNMGYGLPQNSFKAIL
PNPYNDISLAKFVNGKNQQISPLQILTFYNAIANNGKMVKPTFHKKDTTIIKEQIASKEN
IATIQQLLIQKRLTTKVFSDKIPIVGEQGVAIVKEDGDNTVYCLQFCGYYPSDNPQYSII
VSLNKKGLSASGGMAGEITKQIVETNNFF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattattctttgccaaccaagggtatgctcaacagattaattcacatttacaa
gctaaatccaccttacaaaatcatgtcagttccattttaaaagagaatatcaaaaagata
gatgctattaatggacagataataataatggattgtaagtctggagagattaaggcaatg
gtaaacttgatgaatactaaatcaggaatcaagccagcaataagacaattgtcagaacca
actgccttaatgcgtacagtttcattattagcagtattggaacaaggtaaggtaaacctg
aatgacagtattgatactaaagcaggaatgcttgatataaacggctatctgctaaaagat
tacaactggcttagaggaggaaatggaaagacaagcgtacagcaaggctttttgttatca
tcaaacatcgctacatacttaacagttaagcaagcatttggcaaggagtatgacaggttc
tataaagccattaccaatatgggctatggtttaccacaaaatagcttcaaagcaatctta
ccaaatccctacaatgatatttctcttgccaagtttgtaaatggaaagaatcagcagata
tcacctttacagatacttacattttataatgccatagccaataatggtaagatggtaaag
cccacttttcataagaaggatactaccattataaaagaacaaatagcaagcaaggagaat
attgccactatccagcaattacttatacaaaaaagacttactaccaaagtcttctctgat
aaaatccccattgtgggagaacaaggagttgccattgtaaaggaagatggagataacaca
gtttactgcttacagttctgtggctactatccatcagacaatccacaatacagcatcatc
gtttctttgaataagaaaggattatcagcaagtggtggaatggcaggagaaataacaaaa
caaatagtagaaacaaacaactttttttga

DBGET integrated database retrieval system