KEGG   Polaromonas naphthalenivorans: Pnap_0327Help
Entry
Pnap_0327         CDS       T00459                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00330  Arginine and proline metabolism
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01130  Biosynthesis of antibiotics
pna01230  Biosynthesis of amino acids
Module
pna_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Pnap_0327
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Pnap_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH GFO_IDH_MocA NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABM35650
UniProt: A1VJ22
Position
complement(329984..330823)
Genome map
AA seq 279 aa AA seqDB search
MTPQTTDSSNQHIAFIGGGNMASAIIGGLLKRGLPASQIQVVEPFAEQRARLAQQFQIEV
SETAGASLARATLAVWAVKPQTFRQAAEQSRAHTQAALHLSVAAGIRSSTIAGWLGTERV
VRAMPNTPALIGQGMTALFARPAASAADRLAVERVVQTTGQYLWLDEEAQLDAVTALSGS
GPAYVFYFIEAMIEAGTDMGLSREQAQQLAVGTFAGASALAHEATEPPEVLRARVTSKGG
TTYAALTSMEQDGIKEKFMQAMHAARQRASEMGDEFGAA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactcctcaaaccaccgacagcagcaaccaacacatcgccttcatcggcggcggcaac
atggccagcgccatcatcggcggcctgctcaagcgcggcctgccggccagccaaatccag
gtggtcgagccttttgcagaacagcgcgcccggctggcgcagcagttccagatcgaggtc
agcgaaaccgctggcgcatcgctggcccgcgccaccctggccgtctgggccgtcaagccg
cagaccttcaggcaagccgccgaacaaagccgcgcgcatacccaggccgcgctgcacctg
agcgtggccgccggcatccgttcaagcaccattgccggctggctggggaccgaacgcgtg
gtgcgcgccatgcccaacacgccggcgctgatcggccagggaatgaccgccctgttcgcc
cggcccgccgccagcgccgccgaccggctggccgtggagcgcgtggtgcagaccacgggc
caatacttgtggctggacgaggaagcgcagctcgatgccgtgaccgccctgtccggctct
ggcccggcttatgttttttacttcatcgaagccatgatcgaggccggcaccgacatgggc
ctgagccgcgagcaggcgcagcaactggcggtcggcacctttgccggcgcgtcggcgctg
gcgcacgaggccaccgagccacccgaggtgctgcgcgcccgcgtgacgtccaagggcggc
accacttatgcggcgctcacgtcgatggagcaggacggcatcaaggaaaagttcatgcag
gcgatgcatgccgcccgccagcgcgccagcgaaatgggcgatgaattcggcgccgcatga

DBGET integrated database retrieval system