KEGG   Polaromonas naphthalenivorans: Pnap_0333Help
Entry
Pnap_0333         CDS       T00459                                 

Definition
(GenBank) SSU ribosomal protein S14P
  KO
K02954  small subunit ribosomal protein S14
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna03010  Ribosome
Module
pna_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pna00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Pnap_0333
Ribosome [BR:pna03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Pnap_0333
  Bacteria
    Pnap_0333
  Archaea
    Pnap_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S14 YwqJ-deaminase
Motif
Other DBs
NCBI-ProteinID: ABM35656
UniProt: A1VJ28
Position
335667..335972
Genome map
AA seq 101 aa AA seqDB search
MAKQALLQRELKRDKLVAKFAKKHAEFKAIANDFKRTDDERALARLELQKLPRNANPTRQ
RNRCAITGRPRGTFRQFGLARAKIRELAFAGDIPGITKASW
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaagcattactgcaacgtgaactgaagcgcgacaagctcgtcgccaagttt
gccaagaaacacgctgaattcaaggcaatcgccaatgatttcaagcgcaccgacgacgaa
cgcgccctggcccgtctggagttgcaaaagttgccccgcaacgccaacccgacgcgtcag
cgcaatcgctgtgccatcacgggtcgtccgcgtggcacgttccgtcaattcggtttggct
cgcgccaaaattcgcgaattggcttttgctggtgatatccctggtatcaccaaggcaagc
tggtaa

DBGET integrated database retrieval system