KEGG   Polaromonas naphthalenivorans: Pnap_0337Help
Entry
Pnap_0337         CDS       T00459                                 

Definition
(GenBank) SSU ribosomal protein S5P
  KO
K02988  small subunit ribosomal protein S5
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna03010  Ribosome
Module
pna_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pna00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Pnap_0337
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pna03011]
    Pnap_0337
Ribosome [BR:pna03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Pnap_0337
  Bacteria
    Pnap_0337
  Archaea
    Pnap_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S5_C Ribosomal_S5 Pectinesterase Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: ABM35660
UniProt: A1VJ32
Position
337339..337857
Genome map
AA seq 172 aa AA seqDB search
MAKFQAKSQNDAPDDGLKEKMIAINRVTKVVKGGRILGFAALTVVGDGDGRVGMGKGKSK
EVPAAVQKAMEEARRNMTKVSLKNGTLHHNVFGHHGAANVMMAPAPKGTGIIAGGPMRAV
FEVMGITDIVAKSHGSSNPYNMVRATMDALKNSTTASDIAAKRGKSVEEIFG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtttcaagctaaatcgcaaaacgacgctccagacgatggtctgaaggaaaaa
atgatcgcgatcaaccgcgtgaccaaagtggtgaagggcggccgtattctcggttttgcc
gcactcaccgtggtcggtgacggtgatggtcgcgttggcatgggcaagggcaagtcgaaa
gaagtgcctgcagccgtgcaaaaggccatggaagaagcgcgccgcaacatgaccaaggtg
tcattgaaaaacggcacgctgcaccacaatgtgttcggtcaccacggtgcagccaacgtc
atgatggcgccggctcccaagggtaccggcatcattgctggcggtccgatgcgcgcagtg
ttcgaagtcatgggcatcaccgacatcgtggccaaaagccatggttcgagcaacccgtac
aacatggtgcgcgccaccatggatgcactgaaaaattccaccacggcttccgatatcgcg
gccaagcgtggcaaatcagtcgaagaaatcttcggctaa

DBGET integrated database retrieval system