KEGG   Polaromonas naphthalenivorans: Pnap_0342Help
Entry
Pnap_0342         CDS       T00459                                 

Definition
(GenBank) SSU ribosomal protein S13P
  KO
K02952  small subunit ribosomal protein S13
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna03010  Ribosome
Module
pna_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pna00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Pnap_0342
Ribosome [BR:pna03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Pnap_0342
  Archaea
    Pnap_0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S13 FbpA DUF2250 HHH_5 HHH_6 DNA_pol_lambd_f
Motif
Other DBs
NCBI-ProteinID: ABM35665
UniProt: A1VJ37
Position
340050..340415
Genome map
AA seq 121 aa AA seqDB search
MARIAGINIPPQKHAEIGLTAIFGIGRTRARKICEACEIDYAKKIKDLTDSDLEKIRDHI
AQFTIEGDLRRETTMNIKRLMDIGCYRGFRHRRGLPMRGQRTRTNARTRKGPRKAAASLK
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtatcgctggtatcaacattccgccgcagaagcacgccgaaatcggcttgact
gcaatttttggcattggtcgcacacgcgctcgcaaaatttgcgaagcctgtgaaatcgac
tatgccaagaaaatcaaagatctgaccgacagtgacctggaaaaaatccgggaccacatc
gctcagttcaccatcgaaggcgatttgcgtcgtgaaaccacgatgaacatcaaacgcctg
atggacatcggctgctaccgtggcttccgccatcgtcgtggcttgcccatgcgtggccaa
cgcacccggacgaacgcccgtacccgcaagggtccgcgtaaggccgctgcgtctttgaag
aaataa

DBGET integrated database retrieval system