KEGG   Polaromonas naphthalenivorans: Pnap_0344Help
Entry
Pnap_0344         CDS       T00459                                 

Definition
(GenBank) SSU ribosomal protein S4P
  KO
K02986  small subunit ribosomal protein S4
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna03010  Ribosome
Module
pna_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pna00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Pnap_0344
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pna03011]
    Pnap_0344
Ribosome [BR:pna03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Pnap_0344
  Archaea
    Pnap_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S4 S4 Ub-Mut7C TyrRSs_C PCB_OB Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABM35667
UniProt: A1VJ39
Position
340964..341587
Genome map
AA seq 207 aa AA seqDB search
MARYLGPKAKLSRREGTDLFLKSARRSISDKAKFDSKPGQHGRTSGTRTSDYGLQLREKQ
KVKRMYGVLEKQFRRYFEEADRRRGNTGANLLSVLESRLDNVVYRMGFGSTRAEARQLVS
HKAMTVNGQSVNIPSYMVKAGDVIAVRDKSKKQTRIAEALELAKQVGLPAWVDVNADKGE
GTFKKVPDRDEFAADINESLIVELYSR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgttacctcggccccaaggccaaactatcacgccgtgaaggcaccgatcttttc
ctgaaaagcgcccgtcgctcgatcagcgacaaggcaaaattcgactccaagccaggtcag
catggccgtacctccggtacgcgcacttccgactacggtctgcaactgcgtgaaaagcag
aaagtcaagcgcatgtatggcgttcttgaaaagcagttccgccgctacttcgaagaagct
gatcgccgccgtggcaacactggcgccaatttgctgtcggtgctggaatcgcgtctggac
aatgtggtttaccggatgggttttggatcgacacgcgctgaagcgcgccagttggtttcc
cacaaggcaatgaccgtcaacggccagtcggtcaatattccatcttacatggtcaaggcc
ggtgatgtgattgccgttcgcgacaagtctaaaaagcagacgcgcattgctgaagcgctc
gaacttgccaagcaggttggccttcctgcctgggtggatgtcaatgctgacaagggtgaa
ggtaccttcaagaaagtgcctgatcgtgacgaatttgctgccgacatcaacgaatcgttg
atcgtcgagttgtactcacgttaa

DBGET integrated database retrieval system