KEGG   Polaromonas naphthalenivorans: Pnap_0345Help
Entry
Pnap_0345         CDS       T00459                                 

Definition
(GenBank) DNA-directed RNA polymerase subunit alpha
  KO
K03040  DNA-directed RNA polymerase subunit alpha [EC:2.7.7.6]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00230  Purine metabolism
pna00240  Pyrimidine metabolism
pna01100  Metabolic pathways
pna03020  RNA polymerase
Module
pna_M00183  RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pnap_0345
   00240 Pyrimidine metabolism
    Pnap_0345
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    Pnap_0345
Enzymes [BR:pna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     Pnap_0345
Transcription machinery [BR:pna03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     Pnap_0345
DNA repair and recombination proteins [BR:pna03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      Pnap_0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_A_bac RNA_pol_A_CTD RNA_pol_L RNA_pol_L_2 DUF211
Motif
Other DBs
NCBI-ProteinID: ABM35668
UniProt: A1VJ40
Position
341683..342675
Genome map
AA seq 330 aa AA seqDB search
MQTNLLKPKTINVEQLGANRAKVTLEPFERGYGHTLGNALRRVLLSSMVGHAATEVTIAG
VLHEYSSIDGVQEDVVNILLNLKGVVFKLHNRDEVTLSLRKDGEGPITAADIQTPHDVEI
VNPDHVIMNLSHGGKIDMQIKVENGRGYVPGNVRRYGDESPKSIGRIVLDASFSPVKRVS
YTVESARVEQRTDLDKLVLEIETNGAVTAEDAVRASAKILVEQLAVFAQLEGNELGAIIN
DPAPRSSQQFDPILLRPVDELELTVRSANCLKAENIYYIGDLIQRTENELLKTPNLGRKS
LNEIKEVLASRGLTLGMRLESWPPAGLDKR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcagactaatttgttaaaaccaaaaactatcaatgttgagcagcttggcgcaaaccgc
gccaaggtgactctcgagccttttgagcgtggttacggccatacgctgggcaacgcgctg
cgtcgtgtactgctgtcatccatggtgggccatgctgcaactgaagtgactatcgccggt
gttttgcatgagtactcttccattgacggtgtccaggaagatgttgtcaacatcctgtta
aacctcaagggtgtagtcttcaaactacacaaccgcgatgaagtgactttgagcctccgc
aaggatggcgaaggtccgatcactgcggctgatatccagacgcctcatgatgttgaaatt
gtcaaccctgaccatgtgatcatgaacttgtcgcacggcggcaagattgacatgcagatc
aaggtcgagaatggtcgcggctatgtgccgggtaacgtccgccgttatggtgacgagtcg
ccaaagtcgattggccgcattgtgctcgatgcttctttttctccggtcaagcgcgtcagc
tacaccgttgaaagtgcccgcgttgagcagcgtacggatctggataaactggttctggaa
attgaaaccaatggcgcagtaactgcagaagacgcggttcgtgcatcagccaagatactt
gttgaacaactggctgtatttgcccagttggaaggcaatgaattgggcgcaatcatcaat
gatccggcgcctcgcagttcgcagcaattcgatcccattctgctgcgcccagtcgatgaa
ctcgaactcacggtgcgttcggcaaactgcttgaaagcagaaaatatttactacattggc
gatctgatccagcgcaccgaaaatgagctgctcaagactcccaatctgggacggaaatct
ctcaacgagatcaaggaagtattggcctctcgcggcctgacactgggaatgcgtcttgaa
agctggcctcctgccggccttgacaagcgctga

DBGET integrated database retrieval system