KEGG   Polaromonas naphthalenivorans: Pnap_0354Help
Entry
Pnap_0354         CDS       T00459                                 

Definition
(GenBank) amidase, hydantoinase/carbamoylase family
  KO
K06016  beta-ureidopropionase / N-carbamoyl-L-amino-acid hydrolase [EC:3.5.1.6 3.5.1.87]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00240  Pyrimidine metabolism
pna01100  Metabolic pathways
Module
pna_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pnap_0354
Enzymes [BR:pna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     Pnap_0354
    3.5.1.87  N-carbamoyl-L-amino-acid hydrolase
     Pnap_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OHCU_decarbox Peptidase_M20 Peptidase_M28 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABM35677
UniProt: A1VJ49
Position
complement(351271..353049)
Genome map
AA seq 592 aa AA seqDB search
MTITLDQLNAASQAEFTQLLDGSYEHSPWIAAQAWAQRPFASLAQLKLALVRVVRESGRE
AQLALIRAHPELAGKAMLSKTLTAESSHEQGKAGLSNCTPAEFARIHQLNANYNAKFGFP
FILAVRGPRGLGLAKPEIIATFARRLDNPPDFELAEALRNIHRIAEIRLNDKFGHSPDLG
NLVWDWAEQLGTHSDPGYAERGELTVTYLTDAHQACARQLAHWMRDDCSFDEVSIDAVGN
VVGIYHGSDPQARRLLTGSHYDTVRNGGKYDGRLGIFVPMACVRELQRQGRRLPFGLEVV
GFAEEEGQRYKATFLGSGALTGHFDAAWLDQKDADGITMREAMTQAGLRIDDIPALRRDP
ARYLGFVEVHIEQGPVLNALDLPLGVVTSINGSVRYVGEIIGMASHAGTTPMNQRRDAAT
AAAELALYVEKRGGSAENLVATVGMLEVPGGSINVVPGRCKFSLDIRATTDEVRDACAAD
IVHELQALCQRRGLHYRLEETMRAAAAPSARAWQQRWERAVEALGLPVFRMPSGAGHDAM
KLHEIMPQAMLFVRGLNAGISHNPLEAITNDDAELCVRAFQNLLDQLATEFP
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaccttggaccagctcaacgccgcctcgcaggccgaattcacgcagctgctg
gacggcagctatgaacattcgccgtggatcgcggcgcaggcctgggcgcagcgcccgttc
gccagcctggcgcagctcaagctggcgctggtgcgggtcgtgcgcgagtccggccgggag
gcgcaactcgcgctgatccgcgcccaccctgaactcgccggcaaggcgatgctgagcaaa
accctgacggcggaatcaagccatgaacagggcaaggccggcctgagcaactgcacgcca
gcggaattcgcacggattcaccagctcaatgccaactacaacgcaaagttcggttttccc
ttcatcctggcggtgcgcggcccgcgcggcttggggctggccaagccagagattattgcc
acctttgcgcgccggctggacaaccctcccgatttcgagctggccgaggccttgcgcaac
atccaccgcattgccgaaatccgtctcaatgacaaattcggccactcgcccgacctgggc
aatttggtctgggactgggccgagcagctcggcacccacagcgatccgggctatgctgag
cgcggcgaactcaccgtgacctacctgaccgacgcgcaccaggcctgcgcccggcagctg
gcacactggatgcgggacgactgcagcttcgacgaagtgtcgattgacgccgtcggcaat
gttgtcggcatctaccacggcagcgacccgcaggccaggcgcctgttgaccggctcgcac
tacgacacggtgcgcaacggcggcaagtacgacggacggctggggattttcgtgccgatg
gcctgcgttcgtgaactgcagcgccagggccggcgcctgccgtttggcctggaagtcgtc
gggttcgccgaagaggaaggccagcgctacaaggcaaccttcctcggctcgggcgcgctg
accggccatttcgatgcggcctggctggaccagaaagacgccgacggcatcacgatgcgc
gaagccatgacgcaggccggcttgcgcatcgacgacatccccgcgctccggcgcgacccg
gcccgctacctcggctttgtcgaggtgcatatcgagcaggggccggtgctcaacgcgctg
gacctgccgctgggcgtggtcacctccatcaacggcagcgtgcgttacgtcggcgagatc
atcggcatggccagccatgccggcacgacgccgatgaaccagcgccgcgatgcggccacg
gcggcggcggaactcgcgctctacgtcgagaagcgcggcggcagtgcagagaacctcgtg
gccaccgtcggtatgctcgaagtgccgggcggctcgatcaacgtggtgccggggcgttgc
aaattcagcctggacattcgcgcgaccaccgatgaagtgcgcgacgcctgcgccgccgac
atcgtccatgagctgcaagccctttgccagcggcgcggcctgcattaccggctcgaagaa
accatgcgcgccgccgccgcgcccagcgcgcgcgcttggcagcagcgctgggagcgggcc
gtcgaagcgctcggcctgccggtgttccgcatgcccagcggcgccggccatgatgcgatg
aaactgcacgaaatcatgccccaggcgatgctgttcgttcgcggcctgaacgccggcatc
agccacaacccgctcgaagccatcaccaacgacgacgccgagctgtgcgtgcgcgccttc
cagaacctgctcgatcaacttgccacggaatttccatga

DBGET integrated database retrieval system