KEGG   Polaromonas naphthalenivorans: Pnap_0358Help
Entry
Pnap_0358         CDS       T00459                                 

Definition
(GenBank) AAA ATPase, central domain protein
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
pna  Polaromonas naphthalenivorans
Brite
KEGG Orthology (KO) [BR:pna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pna01002]
    Pnap_0358
Enzymes [BR:pna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     Pnap_0358
Peptidases [BR:pna01002]
 Serine Peptidases
  Family S16: lon protease family
   Pnap_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA AAA_5 AAA_2 NACHT AAA_16 AAA_22 AAA_24 RNA_helicase AAA_3 RuvB_N AAA_17 IstB_IS21 MCM
Motif
Other DBs
NCBI-ProteinID: ABM35681
UniProt: A1VJ53
Position
complement(355874..356878)
Genome map
AA seq 334 aa AA seqDB search
MESIQVVPQAPTFTLPVAKVRSVYQIADVERKLGKLQNSEPREHDNLRATYERMLERGPE
RFQMKPSGIPEMAPLYDALPNFTDVLDDVRRHVALSHDSTDGLEVTPMLLLGQPGIGKTH
FARQVADLIGTGMNLVSMGSLTAGWLLSGSASQWKGAKPGKVFESLVDGRYANPVIVIDE
IDKAASDAQYDPLGSLYSLLEHDTASSFVDEFAEVPIDASQVLWITTANDARGIPNPILN
RMNVFEIQPLTPGQARHIARRLYQSIRAGHNWGTRFDDAPSSDVLDKLATLVPREMRRAL
MAAFGNARLASRGMLKVDDLPRSAASKGRIGFMQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaatccattcaagtcgttccccaggcgcccaccttcacgctacccgttgccaaggtg
cgaagtgtctaccagattgctgatgtcgagcgcaagctgggcaagctgcaaaacagcgaa
ccccgcgaacacgacaacttgcgcgctacctacgagcgcatgctggagcgaggccccgag
cgcttccagatgaagcccagcggcattcccgaaatggcccccctctacgacgcgctgccc
aacttcaccgacgtgctggacgacgtgcggcgccatgtggccctgagccacgacagcacc
gacgggctggaggtcacgcccatgctgctgctgggccagccgggcatcggcaagacgcat
ttcgcccggcaggtggccgacctgatcggcaccggcatgaacctggtctcgatgggttcg
ctgaccgccggctggctgctgtcaggctcggcgtcgcagtggaagggcgccaagccgggc
aaggtattcgaatcgctggtggacggccgctacgccaacccggtaatcgtgatcgacgag
atcgacaaggccgccagcgacgcccagtacgacccgctgggctcgctctacagcctgctg
gagcacgacacggcctcttccttcgtggacgagttcgccgaagtgcccatcgatgccagc
caggtgctgtggatcacgacggccaacgatgcgcgcggcattcccaacccgatcctgaac
cggatgaatgtgttcgagatccagccgctcacgcccggccaggcgcggcatatcgcacgg
cgcctctaccagtcgatacgcgccggccacaactgggggacgcgcttcgatgacgcgccg
tcaagcgatgtgctggacaagctggccaccctggtgccgcgtgaaatgcgccgcgccctg
atggccgcgttcggcaacgcgcggctggccagccggggcatgctgaaggtcgatgacctg
ccgcgcagcgcggccagcaagggccggatcgggttcatgcaatag

DBGET integrated database retrieval system