KEGG   Polaromonas naphthalenivorans: Pnap_0360Help
Entry
Pnap_0360         CDS       T00459                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM35683
UniProt: A1VJ55
Position
complement(359491..360561)
Genome map
AA seq 356 aa AA seqDB search
MRLIQPPSRPMSKQISPAPSPKPIAISIAAPIKIASYVLAFLLCVGTLVYGLLPGLLAVC
LGYLLVVALAGEGRIRGPRLSPALAAAVVVLLPLIGLGVLLANAKGMAFGVVGQYQALLH
YLASTVLEIRQKLPADLAIHLPDELTEAQVWLAAYLKSKAQALTGAGTAGLHGFLLAYVG
LVVGALIKGTFRMPTSAPLRFEIRMRAGHFIEAFRQIVVAQFWIAAVNAFFTAVFLLAVL
PLFGVHMPYIAELVTLTFFAGLIPIVGNLICNSVITLVGVSVSPAVGLACLVFLILIHKT
EYIINAKILGKQTNTAAWELLAAMFVGEAVFGLPGLVAAPLYYAYAKKELQVARLV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgatccaaccccccagccgccccatgtccaaacagatatcccccgcgccttct
cccaaacccatcgccatctccatcgccgcgcccatcaagattgccagctacgtgctggca
ttcctgctgtgcgtcggcacgcttgtctatgggctgctgcccggcttgctggcggtttgc
ctgggctatctcctggtggtggcgctggccggcgaaggccgcatccggggaccccggctg
agccccgcgctggcggcggccgtggtcgtccttttgcctttgattggcctgggcgttttg
ctggccaacgccaaaggcatggccttcggcgtcgtcgggcaataccaggcgctgctgcat
tacctggccagcaccgtgctggaaatccgccagaaactcccggccgacctggccattcac
ctgcccgacgaactcaccgaagcccaggtctggctggccgcctacctgaaatcgaaggcc
caggcgctgacaggagctggcacggccggcctgcatggctttttgctggcttacgtgggc
ctggtggttggcgcgctgatcaagggcaccttcaggatgccgaccagcgcaccgctgcgg
tttgagattcgcatgcgtgccggccatttcatcgaggccttccgccagatcgtggtcgcg
caattctggatagccgccgtcaatgccttcttcaccgccgtgttcctgctggcggtgctg
ccgctgtttggcgtgcacatgccctacattgccgagttggtgacgctcaccttcttcgcc
ggcctgattccgattgtcggcaacctgatctgcaacagcgtgatcacgctcgtcggggtc
tcggtgtctccggcggtcggcctggcctgcctggtcttcctgatcctgattcacaagacc
gaatacatcatcaatgccaagatactgggcaaacagaccaacaccgcagcctgggagttg
ctggccgcgatgttcgtcggcgaggcggtgttcggactgccgggcctggtcgcagccccg
ctgtattacgcctacgcgaaaaaagagcttcaggtggcccggctggtctga

DBGET integrated database retrieval system