KEGG   Polaromonas naphthalenivorans: Pnap_0362Help
Entry
Pnap_0362         CDS       T00459                                 

Definition
(GenBank) primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pna00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pnap_0362
Enzymes [BR:pna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Pnap_0362
DNA repair and recombination proteins [BR:pna03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pnap_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD ResIII Helicase_C AAA_25 AAA_30 AAA_22 Bac_DnaA
Motif
Other DBs
NCBI-ProteinID: ABM35685
UniProt: A1VJ57
Position
complement(361263..363392)
Genome map
AA seq 709 aa AA seqDB search
MSHWLQIVVATPAHSAIAGPLTYRSALLLRPGTLVRVPFGRREVLGVVWQVLPDSGGMPE
ASIRDIAGVLDGLAPLSSTWRRLVAFTAGYYQRSLGEVALAALPPQLRDLTTLQLTRRLK
RTVVDTSHPQDTTDLIALSAQQACAIAEFDAETSEKQRPALLFGATGSGKTEVYLRAAAK
VLEQDPEAQVLVMVPEINLTPQLQARFEARFAHLGRERVVPMHSGLTPAQRLKGWLAAHS
GQARLVLGTRMAVFASMPNLRLLVVDEEHDPSYKQQEGARYSARDLAVYRARLETRDREH
PHGACRVLLGSATPSLESWQATIVGRYQRLNMNERIGASPAGQPGGLPTVRRVDMNHQPK
HCVIAPPLLAAIGERVARGEQSMIFLNRRGYAPVLACHDCDWKSDCPHCSAYRVFHKIDR
TLRCHHCGFTERVPRACPSCGNIDIAPVGRGTERLEEHLAELLANVTRPDGGPVRIARID
ADSTRLKGSLESQLASVHAGEVDVLVGTQMIAKGHDFRHITLVAAINTDSALFSSDFRAP
ERLFSLLMQAAGRAGRDAQRSAASEMWVQTFHPDHPLFEALKRHDYPDFAEQQLAERQAA
GLSPFGFSALIRADAKTQEVAQGFLNAAAEAAQTQQLPGHAHVMAYPAVPMTIQRVANIE
RAQMLVESPSRKALQGFLAAWQPLLFETRRQAEFKSLVRWAIDVDPIAI
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgagccactggttgcagatagtggttgccacgccggcgcacagcgccatcgccggcccg
ctgacctaccgcagcgccttgctgctgcgccccggcacgctggtgcgcgttccgtttggc
aggcgcgaggtgctgggcgtggtgtggcaggtgttgccggacagcggcggcatgcccgaa
gcaagcatccgcgacattgccggcgtgctggacgggctggcgccgctgtcatcgacctgg
cgccggctggtggcctttaccgccggctattaccagcgctcgctcggcgaggtggcgctg
gctgccctgccgccgcagttgcgcgacctcacgacgctgcagctgacgcgccggctcaag
cggacggtggtggacaccagccacccgcaagacactactgatttaatagcactcagcgca
cagcaggcgtgcgcaatagccgaatttgatgctgaaaccagtgaaaaacagcggcccgcg
ctgctgtttggcgccaccggcagcggcaagaccgaggtgtacctgcgcgccgccgccaaa
gtcctggagcaagaccccgaggcgcaggtgctggtgatggtgcccgagatcaacctcacg
ccgcagctgcaggcccggtttgaagcgcgctttgcccatctgggccgggagcgcgtcgtg
ccgatgcacagcggactcacgcccgcccaacggctcaagggctggctggccgcgcattcg
ggccaggcgcggctggtgctgggaacgcgcatggccgtgttcgcgtcgatgccgaacctg
cgcctgctggtggtcgatgaggaacacgatccgagctacaagcagcaggaaggcgcgcgc
tactcggcgcgcgacctggcggtgtaccgcgcccggctggaaacccgcgacagggagcat
ccgcatggtgcctgccgcgtgctgctgggctcagccacgccttcgctggaaagctggcag
gcgacgattgtgggccgctaccagcgcctgaacatgaacgagcggatcggggccagcccg
gcaggtcagccgggcggcttgcccacggtcaggcgggtggacatgaaccaccagcccaag
cactgcgtcatcgcgccgccgctgctggcggccatcggcgagcgggtggcgcgcggcgag
cagtcgatgattttcctgaaccggcgcggctatgcgccggtgctggcctgccacgactgc
gactggaaaagcgactgcccgcactgcagcgcctaccgcgtgttccacaagatcgaccgc
acgctgcgctgccaccactgcggcttcaccgaacgcgtgccgcgcgcctgcccgagctgc
ggcaacatcgacatcgccccggtcgggcgcggcaccgagcggctcgaagaacacctggcc
gaactgctggccaatgtcacgcggccggacggcggcccggtgcgcattgcccgcatcgac
gccgacagcacccggctcaagggctcgctcgaatcgcagctggccagcgtgcatgccggc
gaggtcgatgtgctggtcggcacgcagatgatcgccaagggccacgacttcaggcacatc
acgctggtggccgccatcaacaccgacagcgcgctgttttccagcgacttccgcgccccc
gagcggctgttcagcctgttgatgcaggcggcgggccgcgccggccgcgatgcccagcgc
agcgccgccagcgaaatgtgggtgcagacctttcaccccgaccatccgctgttcgaggcg
ctcaagcggcacgactacccggattttgccgagcagcaactggccgagcggcaggcggcc
ggcctgtcgccgttcggtttttcagccttgatacgggccgacgccaagacccaggaagtc
gcccagggtttcctgaacgccgccgccgaggccgcccagacgcagcagctgcccggccat
gcccacgtcatggcctacccggccgtgccgatgacgatccagcgcgtggcgaatatcgag
cgcgcgcaaatgctggtcgaaagcccgtcgcgcaaggcgctgcagggctttctggccgcc
tggcagccgctgctgtttgaaacccgcaggcaggcggaattcaaaagcctggtgcgctgg
gcgattgacgtggacccgattgcgatttga

DBGET integrated database retrieval system