KEGG   Polaromonas naphthalenivorans: Pnap_0366Help
Entry
Pnap_0366         CDS       T00459                                 

Definition
(GenBank) hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM35689
UniProt: A1VJ61
Position
complement(365781..366377)
Genome map
AA seq 198 aa AA seqDB search
MSRYLLPRPGGVLTWLSVRPPSLERRLFEHLLGAPAAVELNVQALASALCHPVQAIARAL
FALNRQASIEVQDGAAPLCAAASPALRAGLRQGIAGLAQDLIDISGGCGEIMLASDDGFC
IAQADLSAQRAQALAAHLPRDDGSAMQFRMQLCFADRTLYFCASSRIDLKHPVMLRLGAD
LVQGCQLQPLQRNHDAEK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctacctgctgccccggccaggcggtgtgctgacctggctgtccgtcaggccg
cccagcctggagcgccgcttgtttgaacacttgctcggggcgcccgcagccgttgaactg
aatgtgcaggcgctggcatcagccctgtgccacccggttcaggccattgcccgtgccttg
ttcgcgctcaaccgccaggcgagcatcgaggtgcaagacggcgccgcgcccctgtgcgcg
gcagcgagtccggcgctgcgcgcgggcttgcgccagggcattgcgggtctggcgcaggat
ttaatcgacatttccgggggctgcggcgagatcatgctggcctctgacgatgggttttgt
attgcccaggccgacctgtccgcgcagcgggcgcaggcgctggcggcgcacttgccccgg
gatgacgggtcggccatgcaatttcggatgcagctgtgctttgccgacagaacgctgtat
ttttgcgccagttcccggattgacttgaagcatccggtgatgctgcgcctgggcgctgat
ctggttcaaggttgccagctccagccgctacagagaaaccatgatgcagaaaaatag

DBGET integrated database retrieval system