KEGG   Polaromonas naphthalenivorans: Pnap_0370Help
Entry
Pnap_0370         CDS       T00459                                 

Definition
(GenBank) protein of unknown function, ATP binding protein
  KO
K06945  uncharacterized protein
Organism
pna  Polaromonas naphthalenivorans
Brite
KEGG Orthology (KO) [BR:pna00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Pnap_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_1 Ras
Motif
Other DBs
NCBI-ProteinID: ABM35693
UniProt: A1VJ65
Position
complement(368774..369337)
Genome map
AA seq 187 aa AA seqDB search
MGPVGSGKTEAIKSISDIEVINTDVRATDDVRKLKSHTTVSMDVGVLHLSGHDKLRLYGA
PGQDRFDFMWDILLLQAKGVALLLNHASADPLAELDHYLQAIRERAPGNGLPMVIGITHI
DEKPERPLSIYEDHLRQEKIVFYGVMPPVIEVDARLRSHVRSLLLVMVAQLEMAARFPKV
IPRLAAR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgggacctgtgggctcgggtaagaccgaggccatcaaaagcatttcggatattgaagtg
atcaataccgatgtgcgcgccactgacgatgtgcgcaagctcaaatcccacaccaccgtg
tcgatggatgtcggggttctgcatttgtcaggccatgacaagctgcggctgtatggcgcg
ccggggcaagaccggtttgacttcatgtgggacattttgctgctgcaggccaaaggggtc
gcgctgctgctgaaccacgccagtgcagacccgctggctgaactcgatcattacctccag
gccatccgtgagcgcgctcctggaaatggcctgcccatggtcatcgggatcacgcacatt
gacgagaaacccgagcggcccttgagcatttacgaggaccacctgcgccaggaaaaaatt
gtgttttacggtgtcatgccgcctgtgatcgaggtggatgcacgccttcgcagccatgtc
cgcagcttgttgctggtcatggtggcgcagctggagatggcggcgcgctttcccaaagtg
attcctcggctggcagcgcgatga

DBGET integrated database retrieval system