KEGG   Polaromonas naphthalenivorans: Pnap_0373Help
Entry
Pnap_0373         CDS       T00459                                 

Definition
(GenBank) hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4262
Motif
Other DBs
NCBI-ProteinID: ABM35696
UniProt: A1VJ68
Position
371606..372061
Genome map
AA seq 151 aa AA seqDB search
MERGDDQRTKEDIGKYGCSVMHVFDADGDLPSFAYSIGIQQETGAPEAFVIGLKRPMAHS
VINEYNRRTREGERFEIGKYYAGFLGGFEVCIGAVPRSTYDEYFGQNIDFYDGREFDVVQ
IIYPTTKGVWPWAPDASEAFIQGQPILAKQG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcggtgatgatcaaaggacgaaagaggatattgggaagtacggctgcagtgtt
atgcatgtgttcgatgccgacggcgatctgccgtccttcgcgtactccatagggattcag
caggagactggcgcacctgaggcttttgtcattggccttaagcgacccatggcccactct
gtcatcaacgagtacaacagacggactcgcgagggtgaacggtttgagattggcaaatat
tacgccgggtttctaggtggctttgaggtatgcataggtgcggtgccacgatcaacctac
gacgagtattttggccaaaacatcgatttctatgacgggcgagaattcgacgtagttcag
atcatctatccgaccaccaagggagtttggccttgggcgcctgacgcgtcagaggcgttt
attcagggtcaacccatactcgcgaagcaaggttag

DBGET integrated database retrieval system