KEGG   Polaromonas naphthalenivorans: Pnap_0377Help
Entry
Pnap_0377         CDS       T00459                                 

Definition
(GenBank) transcriptional regulator, XRE family
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3
Motif
Other DBs
NCBI-ProteinID: ABM35700
UniProt: A1VJ72
Position
375774..376268
Genome map
AA seq 164 aa AA seqDB search
MHKMRNTMPAPPLAISNAMATRLGALGQQIRTRRKALRLSATVAAEAAGLSRVTLHRMEK
GAPAVTMAAYLNVMAALGLDFSLSLPADPAAVAPAADHTGWIPARVRLGDYPQLKQLAWH
VQGVDELTPAEALSIYERNWRHIDVAALQPHEQQLVDALRLALT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatgagaaacactatgccagcaccaccccttgccatctcaaacgccatggcc
acccgattgggtgcgctggggcagcagattcgtacccgccgcaaggcacttaggctcagc
gccacggtggctgcagaggcggctggcctgtcgcgcgtgactttgcaccgcatggaaaag
ggcgcgcccgccgtcaccatggcggcctacctgaacgtcatggcagcgctggggctggac
ttcagcctgagcctgccagccgaccccgccgccgttgcgcctgccgccgatcacaccggc
tggattccggcgcgcgtgcgcctgggtgattacccgcagctcaagcaactcgcctggcat
gtgcagggcgtggatgaactgacaccggccgaggcgctcagcatttatgagcgcaactgg
cgccatatcgacgtggcagcgctgcagccgcatgagcaacagctggtcgatgccttgcgc
ctggccctgacatga

DBGET integrated database retrieval system