KEGG   Polaromonas naphthalenivorans: Pnap_0378Help
Entry
Pnap_0378         CDS       T00459                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AbiEii
Motif
Other DBs
NCBI-ProteinID: ABM35701
UniProt: A1VJ73
Position
376278..376976
Genome map
AA seq 232 aa AA seqDB search
MFERPHHQRIAQVLRALNAPLLRENLCLFGGGTAIALRYGEYRESVDMDFLVSSLASYRN
LRQLLTNPGGIAGIVHAQAAPLEQIKEVRADQYGIRTLLRVDGQPIKFEIILEGRIQLAA
PTAKDEVCGVATLSPLDMAASKLLANSDRWGDDGVFNRDVIDLAMMKPSLALLRQALLKA
HGAYGQAIRQDLDKALLRLQTRQGWLERCMQAMAMVEPKAVVWQRLRALRRN
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacgaccccaccaccagcgcattgcacaggtactgcgcgcgctcaatgcgccg
ctgctgcgtgaaaacctctgtctgtttggcgggggtacggccatcgcgctgcgctatggc
gaataccgtgagtcggttgacatggactttctggtatcaagccttgccagctaccgcaac
ctgcgccagttgctgaccaaccccggcggcattgccggcattgttcatgcccaggcggca
cccttggagcaaatcaaggaggtgcgggcggatcaatatggcattcggaccctgctgcgt
gtggacggtcagcccatcaagttcgagattattttggagggccgcatccagctggcggcg
ccgacggcgaaagatgaagtctgcggtgtcgccacgttgagccccctggacatggctgcg
tccaagctgctggccaattcagaccgatggggcgacgacggcgtattcaaccgcgacgta
attgacctggccatgatgaagccgtcgctggcactgctgcgccaggcactgctgaaagcg
cacggcgcctatggccaggccatccggcaggacttggacaaggctcttttgcggctgcaa
acccggcagggctggctggagcgctgcatgcaggccatggccatggtggaacccaaggcc
gtggtgtggcagcggcttcgggcgctgcgcaggaattga

DBGET integrated database retrieval system