KEGG   Polaromonas naphthalenivorans: Pnap_0382Help
Entry
Pnap_0382         CDS       T00459                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM35705
UniProt: A1VJ77
Position
378619..378939
Genome map
AA seq 106 aa AA seqDB search
MMKKVTKGVAKRLIFSLIALSALGGCAVYGPPGPYVYGTDVNGQPIYAPAPVNAAPSYYS
PYYYDPVYVGPPVFFNFGFYSRGGGFHGGGRGFHGGGRGSHGGGHR
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaagtcacgaaaggcgtggcgaaacgcctgatcttttcgctaattgcgctg
tctgccttgggcgggtgtgcggtttatggtccccccggaccctatgtgtacggcacggac
gtcaatggccagcccatttatgcgcctgcacccgtcaatgcagccccatcgtattactcc
ccttattactacgaccccgtgtacgtggggccgcccgtctttttcaacttcggcttttac
tcaaggggcggaggctttcatggaggcggtagaggttttcacggcggtggccggggctct
cacggcggcggtcatcggtag

DBGET integrated database retrieval system