KEGG   Polaromonas naphthalenivorans: Pnap_0386Help
Entry
Pnap_0386         CDS       T00459                                 

Definition
(GenBank) helix-turn-helix domain protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 MqsA_antitoxin HTH_23 HTH_28 HTH_19 MerR RelE YdaS_antitoxin HTH_17 MerR_1
Motif
Other DBs
NCBI-ProteinID: ABM35709
UniProt: A1VJ81
Position
382949..383554
Genome map
AA seq 201 aa AA seqDB search
MITTMHTVSETEIFQKYAEGVWLEAERVEFINWIAANPLAGDVVPGSNGCRKVRWSRSGR
GRRGGARVIYFNELEGRIWLLIVYAKANSTTCRLHFWHNLNTRWNMAKPIDAEMEQFQND
LLASVRQMKAGKAARTTVVALTPAADARAKVGMSQSEFAALLGVSVRTLQDWEQGRREPS
GAAKTLLRIAARTPEAVRLAV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgattacaaccatgcacaccgtttctgaaaccgagatttttcaaaagtacgctgaaggc
gtgtggcttgaggctgagcgcgtcgagttcatcaactggattgcggccaacccgctggcc
ggcgatgtggtgccgggctccaacggctgccgcaaggtgcgctggagccgcagcggcagg
ggcaggcgcggcggcgcgcgggtgatttatttcaacgagcttgaggggcgcatctggctg
ttgatcgtctatgcgaaagcaaattcgacaacctgccggctgcatttttggcacaactta
aacacgaggtggaacatggctaaaccaatcgacgcggaaatggaacaattccaaaatgac
ctgctggcgtccgtccgacaaatgaaggcgggcaaggcggcgcgcacgactgttgtcgcc
ctgacgcctgccgccgacgccagggcgaaggtaggaatgtcgcagtccgaatttgcagcg
ctgctgggcgtgtcggtgcgtaccttgcaggactgggagcaaggcaggcgcgagccatcc
ggcgcggccaagacgctgctgcgcattgcggcgcgcacgccggaggcggtcaggctggca
gtctga

DBGET integrated database retrieval system