KEGG   Polaromonas naphthalenivorans: Pnap_0387Help
Entry
Pnap_0387         CDS       T00459                                 

Definition
(GenBank) Radical SAM domain protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM B12-binding DUF4080
Motif
Other DBs
NCBI-ProteinID: ABM35710
UniProt: A1VJ82
Position
383746..385404
Genome map
AA seq 552 aa AA seqDB search
MPSPQAPDSTFSPAIVLATLNAKYIHAALGLRCLLANLDRHGGAGLRAVTQLREFTIGQR
PVQIVESLLALSPKVIGLGVYIWNVVETTQVVRLLKTLRPDIKIVLGGPEVSFETGEQEI
CRLADHVVTGWGDVSFPKLCRALLDGPQPLMKIIAGEQPPLDALALPYGEYTDEDLAKRL
LYVEASRGCPFKCEFCLSSLDKTAWAFELDRFMAEMALLYRRGARNFKFVDRTFNLKVDF
SVRILQFFLDRMKDEAGAVQAAPGLFVHFEVVPDSLHERLKALIAQFPAGSLQFEVGIQS
FNPEVQQRISRKQDNAKTAENLRWLVTQSQAHVHADLIFGLPGETLQSFAEGFDRLHELA
PHEIQFGILKRLRGTPITRHTLDFAMAYDPQTPYTILQTSTIDFATMQRIQRFARYWEMV
ANSGRFSAALRLLLRDGPEVAGSAFHHFLDFSDWLWRTTAKTHEFALEKLVDVLFEHLTA
VRGLNDDAVRAALLADYRASGARGRPQCLADLLAAGRADLPAGAAKPRSERQGRHVSQQT
HRDAIQQAAAAA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccctcaagcgcctgattcgaccttttcgcccgccatcgtcctggccacgctc
aatgccaagtacatccacgccgcgctgggcctgcgctgcctgctggccaacctggaccgc
cacggcggcgccggcctgcgcgccgtgacgcagctgcgcgaattcactattgggcagcgg
cccgtgcagatcgtcgaaagcctgctggcgctcagccccaaggtgatcgggctgggcgtc
tatatctggaacgtggtcgaaacgacgcaggtcgtgcgcctcctgaaaaccctgcgcccc
gacatcaagatcgtgctcggcgggccggaggtcagctttgaaaccggcgagcaggaaatc
tgccggctggccgaccatgtggtcaccggctggggcgacgtgagttttcccaagctgtgc
cgcgccttgctcgacggcccgcagccgctgatgaaaatcatcgccggcgagcagccgcct
ttggacgcgctggccttgccctacggcgaatacaccgacgaggatctggccaagcgcctg
ctgtatgtcgaagcctcgcgcggctgcccgttcaagtgcgagttctgcctgagttcgctc
gacaagaccgcgtgggccttcgagctggaccgcttcatggccgaaatggcgctgctctac
cggcgcggggcgcgcaatttcaagttcgtggaccgcacgttcaatttgaaggtggatttt
tcggtgcgcatcctgcagtttttcctggaccgcatgaaggacgaggcgggcgcggtgcag
gccgcgccggggctgttcgtgcatttcgaggttgttcccgacagcctgcacgagcggctg
aaagcgctgatcgcgcagtttccggccggctcgctgcagttcgaggtcggcatccagagc
ttcaaccccgaggtgcagcagcgcatttcgcgcaagcaggacaatgcaaaaaccgccgag
aacctgcgctggctggtcacgcaaagccaggcgcatgttcacgccgacctgatcttcggc
ctgccgggcgagacgctgcagagctttgccgagggctttgaccgcctgcatgaactcgct
ccgcatgaaatccagttcggcatcttgaagcggctgcgcggcacgccgatcacgcggcac
acgctggactttgcgatggcctacgacccgcagacgccgtacacgattctgcaaacctcg
acgattgactttgcgaccatgcagcgcatccagcgctttgcgcgctactgggaaatggtc
gccaactcgggccggttttcagcggcgctgcgcctgctgctgcgggatggcccggaggtg
gcgggttcggcctttcaccatttcctggacttcagcgactggctctggcgcacgacggcc
aagacgcatgaattcgcgctggaaaagctggtcgatgtgctgtttgagcacctgacggca
gtgcgcgggctgaacgatgacgcggtgcgcgccgcgctgctggccgattaccgcgccagc
ggcgcgcgcggccggccgcaatgcctggcggatctgctggctgccgggcgtgcggacttg
ccggcaggggcggccaagccccggtccgagcggcagggccggcatgtcagccagcaaacg
caccgcgacgccattcaacaagcggcggcggctgcctga

DBGET integrated database retrieval system