KEGG   Polaromonas naphthalenivorans: Pnap_0388Help
Entry
Pnap_0388         CDS       T00459                                 

Definition
(GenBank) hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IncA Trimer_CC Mnd1 Apolipoprotein SHE3 HIP1_clath_bdg Phage_Mu_Gam Macoilin Spc7 TPR_MLP1_2 APG6 HemX V-SNARE Plasmid_RAQPRD DUF4407 TBPIP DUF3829 Mis14 Lectin_N ZapB DUF1451 Syntaxin-6_N ABC_tran_Xtn
Motif
Other DBs
NCBI-ProteinID: ABM35711
UniProt: A1VJ83
Position
385516..385935
Genome map
AA seq 139 aa AA seqDB search
MKKSLSVIGLVLVVAAASVACDKIKSPMPELQKSPAPSGQASPPEGERTAFAQAAQKELD
ELKVTIAEFKAKAEASGAQTKTRLGEEVKKLEADLGEAQQRLAALKAATVESWNQVKASF
SSSLEQLKRGVENFRKNPV
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccttgtcggtcattggcctggtcctcgtggttgccgccgcgtccgttgcg
tgcgacaagatcaagtcgcccatgccggaacttcaaaaatcccctgcgccgtcaggccag
gccagccccccggagggtgagcgcacggcctttgcgcaggccgctcaaaaagagctggac
gagctgaaggtgacgattgccgaattcaaggcaaaagccgaggcttcgggcgcccagacc
aagaccaggcttggcgaggaagtcaaaaaactcgaagccgatctgggtgaagcgcagcag
cgtttggccgcgctgaaagccgccacggtggaatcctggaaccaggtcaaagcgtcgttc
agcagttcgctggagcaactcaagcgcggcgtcgagaactttcgcaagaacccggtctga

DBGET integrated database retrieval system