KEGG   Polaromonas naphthalenivorans: Pnap_0400Help
Entry
Pnap_0400         CDS       T00459                                 

Definition
(GenBank) phenazine biosynthesis protein PhzF family
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhzC-PhzF Pro_racemase
Motif
Other DBs
NCBI-ProteinID: ABM35723
UniProt: A1VJ95
Position
complement(398447..399379)
Genome map
AA seq 310 aa AA seqDB search
MTPRLFKQVDVFTSTPYLGNPLAVVLDGSGLDDEAMQRFARWTNLSETTFLLPPADASAD
YRVRIFTPGGELPFAGHPTLGSCHAWLQAGGQPKSRDFIVQECQVGLVKVRREGPRLAFA
APPLRRSAPSPMLLPRVAAALGLKAHQILAVQQLDNGPVWLGLLLDSPDTVLQLNINHLA
LQALQVHIGVAAVYPAAEAAPLIARANREARAFGQTPLPTATLAQAPDLEVRAIVASTTV
YEDPVTGSLNAGLAQWLMADGHMPERYLASQGLCLGRAGQVHLERDAQGQVWVGGDSVTC
IDGQVMLGSN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacgccccgcctgttcaagcaagttgacgtttttacttccacgccctacctgggcaac
ccgctggcggtggtgcttgacggcagcgggctggacgacgaggcgatgcagcgctttgcg
cgctggaccaacctgtcggaaaccacgtttttactgccaccggccgatgcgtcggccgac
taccgggtgcgcatcttcacgcccggcggcgagttgccttttgccggccacccgacgctg
ggcagctgccacgcctggctgcaggcgggcggccagccaaaatccagggatttcatcgtc
caggaatgccaggtcgggctggtgaaagtgcggcgtgaaggccctcgcctggcctttgcc
gcgccgccgctcaggcgctcggcccccagccccatgctgctgcccagggtcgccgcggcg
ctgggcctgaaggcgcaccagattctggcggtccagcaactggacaacggcccggtctgg
ctgggcctgctgctggacagtcccgataccgtgctgcagctcaacatcaatcacctcgcg
ctgcaggcgctgcaggttcacatcggcgttgcagcggtttaccctgcggccgaagcggcc
ccgctgattgcccgcgccaaccgcgaagcgcgtgcctttgggcagacgcccctccccacg
gccacccttgcgcaagcgcccgaccttgaagtgcgcgcgattgtcgcgtccaccaccgtc
tatgaagaccccgtcaccggcagcctcaatgccggcctggcgcagtggctgatggccgat
ggccacatgcccgagcgctacctggcgtcgcaaggcctgtgccttggccgcgccggccag
gtgcatctggagcgcgatgcgcaaggccaggtctgggtcggcggcgattcggtgacctgc
atcgacggccaggtcatgctgggatcgaattga

DBGET integrated database retrieval system