KEGG   Polaromonas naphthalenivorans: Pnap_0406Help
Entry
Pnap_0406         CDS       T00459                                 

Definition
(GenBank) conserved repeat domain protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF11 PH_12
Motif
Other DBs
NCBI-ProteinID: ABM35729
UniProt: A1VJA1
Position
407611..414867
Genome map
AA seq 2418 aa AA seqDB search
MATLLRRLRASRSPGAKHTLLSVCFALFSVPPATATPSGGTEKSQFFLNTNAGLAQRGPR
KVSDVLFSSCIQRFIAALALGLAMLLAHVPAQAIPAQAGTVIRNVASATYVPAGFTQVET
ADSNHVLVTVQAVEALSLTQDQNVVRPPSVQVTLNHLLTNTGNVRSGYTIGFVGNGAGCP
TQILNLSALRVLHDLNNNGVADAGDPVVTLGASGSITLQPGETAGLLVQGTLPASSAGSA
CVALTATTTAQATTASNRDIITVSNAAVLSLTKTASYPGVVVPGTTRIDFTVTGTNIGAQ
DAQPVGTAAPANTAIVVNGAPINLVLIRDMIPAGTQYMPGTLQTTAAGAIRLFRLAGDTA
FSYRTEDDASAVEVAIGIPAAVVRNGTVALQFAVRAKADLSGEIRNIAQSYYHDGASPAV
SPSNTVIIASSQGRIGVAKAASAPLLNQAANGELDGTATVRFSVLIRNYGSTALYSVQAP
DVLEGAGATQFGSYTSNVVPAANQYTIVPGSLVIAKPNGSVAGTVAAINPAFNGTAAAQN
LLAAGALLPAGADITVQFDARINFTGRTGTLYNTVRGQASVSPGDTPGIFDDSSNGTNPD
VNGNGNPNDDSLPTPVSTLLPALSIIKTVSLPRRVSLGVYEFDYTFKVTNTGQAEAPHVR
VIDNLNCTFDMDKAEGAIASWELVTRPIVKHGNLKTSASFTGRATCNRNQLNSTDPYLLP
TEVVLSLVDGSRPLAPGQSEEVTLTLRVTEKPASIGSHLTLTNKAWAAAFGQNTVNVTPS
LLVAAGSNSVRSLLLDPEGTVYNSITRQPVAGALVTYSRLSCSSGAGGPVTAAEIYGSGT
GVYTFNANGTVSMTTGADGAWQFFLQSPPVTNLCTYGITVAPPVGSGYVASQLIPVTPGS
FDSCGAIVPNEAPPQNGEPTTHYFVLRAGVNPDNSSCEAIHNHIPLDPGNLMGLVLRKDG
SKKTAEFGDFIDYALTLTNKTGFPVTGATFNDFLPAGFAYVPNSARLNGAATANPAGGAG
PQLVFSFPSLSLGVDQSATVRYRLRIGVGAPTSGDAVNRAQASSGPMQSNQASWRVRVTG
GVFSDEAFAFGTVHMECRRDGKEADGLKNGGEEIGIPGVRLFMEDGTSVVTDIEGKWSLY
GLKPVTHVLRVDETTLPPGAQLDLLDNRNANNPASRFVDLKKGEFHKANFIVGNCDAPGV
FQDVAARRKSLADRPDAEGEAAVRVRLDPEAKAISVGDTRSLPATGQSSLTGAAGITVPA
SQALIQLPTGTANTNTFIGGVASAGALNGTLGQAQQAGAFSPLIPLAGNNEVNGRSGFLL
PAAQPLLQQAVPSSIELEKVMHSLDNSAGFIDLKDQDTVASQTLNVRVKGAAGTQLRLHV
NGQPIDDRRVGKKVVLPSASLGAWEYIGVQLKPGINTLRLDVVDDYGVTRGTQQITLVAP
DKLSLIQIDAPETAQADLRTPVLIKVRLTDASGIPVTGRMQVTLEADRGRWLENDLNPSE
PGAQVFIEGGVAEFRLLPPGEPGDMRVRVSAGTFVKEARVALLPELRPMIGVGIIEGTLD
FTKRSALTLGQMPAGAAFETELSGFASDGTSSSRGAARSAFFFKGAVQGDYLLTAAYDSD
KTTKDRLFRDIRPDEFYPVYGDSSVRGFDAQSTQKFYVRIDKNRSYLLYGDFTTASSSEV
RQMSQSSRTLTGIKNVYESDTVRATSYASRTAQTQRIEEFPALGISGPYHLNAGNGDLLA
NSEKIEILVRDRNQPNIVLQTTSVARFTDYTIEPLTSRLLFTRPIASVDTNLNPQSIRVT
YEVDSGGAKFTVAGTDVQVKLGEKLQVGMVASTDENPENKRKLGALTAIAHIAESTTVAA
ELVRTETDLKGTGSAGRIEVRHHDEKLGAVAQIAKTSASFDNPGSAFSAGRTEAVARAQY
KLDDTTQVRGEAIYSKDALTTGDRKGVAVGVQKKLSETLLGEVGVRHGENSSPTASMFDY
NQVSSSSALGAGSLGNSVTSLGASAAAAGTSNQDITTVRGRLTTVVPHLPQAQVFVEAEQ
DINHGDRHVLAAGGNYAITDKTRAYGRYEFISSLDGPYSLNNSSSRNIGILGIESNYMEG
GRVYNEYRLADSLDGRTGQAAMGVRNTFKLNEQWRLTAGIERTKSIGSSASGIVGRGNST
AIVTGAEYLSDRVKASGILEARQGDDSNSYLSSLGVGYKIDTDWSLLARSIISESKGQGT
NAGNDRLLSRQQIGIAYRPVDQDKWNALARYEHKTERVNGAGSVLGAVNSSSVFGSNAPG
TYSADIVSSHFNYNPQRGTYLTGRYAGKVSSADDGFLGSSYWAHLVQGRYTRDLSRDWDV
GLQAGLLYGKGGALQKTAGVELGYQVAKDLWVSAGYNVVGLKDRDLTAGEYTSEGVYIRL
RFKFDENIFSTALPAVTK
NT seq 7257 nt NT seq  +upstreamnt  +downstreamnt
atggctaccctgctccggcgccttcgggcaagccggagccctggtgcgaaacacacgctc
ttgagcgtttgtttcgcgcttttttctgtgccacctgcaacggcgacgccatcaggtggc
acagaaaaaagtcaattttttcttaatacaaacgcagggctcgcacagcgaggtccgcga
aaagtgagcgatgtgctgttttcttcctgtattcaacgctttatagctgcgctggccctt
ggcctggccatgctgctggcccatgtgccggcacaggccattcccgcgcaggctggcacg
gttattcgcaatgtggcgtccgctacctatgtgccggccggttttacccaagtagaaacc
gctgattccaaccatgttttggtgaccgtccaggccgttgaagcgttgtcgctgacacaa
gaccaaaacgtcgtgcgtcctcccagtgtgcaggtcacgctcaatcatctgctgaccaac
accggcaatgtccggtctggctacacgataggttttgtaggcaacggcgcgggctgtccg
acccagatcctgaacctcagcgccctgcgcgtgctgcacgatctcaacaataacggggtg
gcggatgctggcgacccggtcgtcacgctgggcgccagcggctccatcacgctgcaaccc
ggcgaaacggccggcctgctggtacagggaaccttgccggcgtcatctgccggaagcgcc
tgcgtggcgctgactgccaccaccacggcccaggccaccaccgccagcaaccgcgacatc
atcaccgtcagcaatgcagccgtcctgtcgctgaccaaaactgccagctaccccggcgtg
gtagtgccaggcacgacccgcatcgacttcaccgttaccggcaccaacatcggtgcgcaa
gacgcgcagcctgtcgggacggctgcccccgccaacaccgccatcgtggtcaatggcgcg
ccaatcaacctggtgctgattcgcgacatgattcctgccggcacgcagtacatgccgggc
acgttgcaaaccaccgctgctggcgccattcgcctgttccgcctggcaggtgacactgcc
ttcagctatcgcaccgaggacgacgcttccgcagtggaagtggccatcggtattccggct
gctgtggtgcgaaacggcaccgtggccctgcagtttgccgtgcgcgccaaggctgacctg
agcggcgagatccgcaacattgcacaaagctattaccatgacggcgccagccccgcagtg
tcgccttccaacacggtcattattgcgtccagccagggccgtatcggcgtggccaaggcc
gcttcggcgcccttgctgaaccaggcggccaatggcgagttggacggcacagccaccgtg
cgcttcagcgtgctcatacgcaactacggcagcactgcgctgtattccgtacaggcgcct
gatgtgctggaaggcgctggcgccacgcagtttggcagctacaccagcaatgtcgtacct
gctgccaaccaatacaccatcgttcctggttcgctggtcatcgccaaacccaacggcagc
gtggctggcacggtagcagccatcaaccccgcatttaacggcaccgcagcagcgcaaaac
ctgctcgccgctggcgcgctgttgccggcaggcgcggatatcacggtgcagttcgatgcg
cgcatcaactttaccggccgcactggcacgctgtacaacaccgtgcgcggccaggcgtcc
gtcagtcctggcgacacgcccggtatttttgacgactcgtccaacggcaccaaccccgat
gtgaacggcaatggcaaccccaacgacgacagtttgcccacgccagtgtccacactgctg
ccagccctgtcgatcattaaaactgtttccctgccgcgtcgcgttagcctgggcgtgtat
gagttcgactacaccttcaaggtcaccaacaccggccaggcagaggcaccccatgtgcgg
gtcatcgataacctgaactgcacctttgacatggacaaggccgaaggcgccattgcctcg
tgggaactcgtcacccggcccatcgtcaagcacggcaacctcaagacttcagccagcttc
accggccgggcaacctgcaaccgcaaccagttgaacagcaccgacccttacctgttgccc
acggaagtggtgctgtccctggtggacggcagccgtccgctggccccgggccaaagtgaa
gaggtcaccttaaccttgcgcgtcaccgaaaagccggcctccattggatcgcacctcacg
ctgaccaataaagcctgggcggccgcgtttggacaaaacacagtcaatgtcacgccctca
ctgctggttgcggcgggatcgaattcagttcggtccctgctgctcgacccggaaggcacg
gtttacaactccatcacacgccagcccgtggccggcgcactcgttacctacagccgcctg
tcctgcagcagtggcgcaggcggtcctgttaccgcggcagaaatttacggcagcggaaca
ggggtttacacattcaatgccaatgggacggtgtccatgaccacaggcgcggatggcgcc
tggcagttctttctgcaatcgccgccagtcaccaacctgtgcacctacggcatcacggtg
gcgccaccagtgggcagcggctatgtggcttcccaactgattcccgtcaccccgggcagc
tttgacagctgcggtgccattgttcccaatgaagcgcccccacaaaatggcgagcccaca
acgcattactttgtcttgcgcgccggtgtgaatcccgacaactccagttgcgaagccatc
cacaaccacattccgctagaccctggaaatctgatggggctggtgctgcgcaaagacggt
agcaagaaaacggcagagttcggcgacttcatcgactatgccctcacgctgaccaacaag
acgggttttcctgtcactggcgctactttcaacgacttcttgccagccgggtttgcctat
gtgcctaacagcgcccgcctgaatggcgcggccaccgccaacccggcgggtggcgcaggc
ccccaactcgtgttcagttttccgtccttgtcgcttggcgtggatcagtccgccacggtg
cgctatcgcctgcgcattggtgtgggcgcgcctacatcgggcgacgcggtcaatcgcgca
caagccagttccggcccgatgcagtcgaaccaggcgtcatggcgcgtgcgcgtcaccggt
ggtgttttttcagacgaagcctttgccttcggcacggtccatatggagtgccgccgcgat
ggcaaggaggctgatggcctgaaaaatgggggcgaagaaataggcattcccggtgtgcgc
ctcttcatggaggacggcaccagcgtcgttaccgatattgaaggcaagtggagtctgtac
ggtctcaagccggtcacgcacgtcttgcgtgtggatgaaactacgttgccgcccggcgcc
cagctcgacctgctggacaaccgcaacgccaacaacccggccagtcgttttgtcgatctg
aaaaaaggcgagtttcacaaggccaacttcatcgtcggcaactgcgatgcgccgggcgtg
tttcaggacgtagccgcccgccgcaagagcttggccgaccggcctgacgcagaaggcgaa
gccgcagtacgcgtgcgccttgatcccgaagccaaagccatcagcgtgggggacacccgt
tccttgcccgccaccggccagtccagccttacgggcgccgctggcatcaccgtgccggca
agccaggcgttgatccagttgcccactggcaccgctaataccaataccttcatcggtggc
gtggccagtgctggcgcgctcaatggcacgctgggccaggcgcaacaagccggcgctttt
tccccgctaattcccctggctggcaataacgaggtcaatggccgcagcggcttcttgctg
cccgctgcccagcctttgctgcaacaagccgtgcccagcagcatcgagcttgaaaaagtc
atgcatagcctggacaacagcgccggctttatcgacctgaaagaccaagacactgttgcc
agccaaaccctcaacgtacgtgtcaagggcgcggccggcacgcaactgcgcctccacgtc
aacggccagcctattgacgaccggcgggtcggcaaaaaagtcgtgctgccttcggccagt
ctgggcgcctgggaatacattggcgttcagctcaagcccggcatcaataccctgcgcctg
gatgtggtggacgactacggcgtgacccgcggcacccagcagatcactctggtagcaccc
gacaaactcagcctcattcagatcgatgcgcctgaaaccgcccaggccgacttacgcacc
ccggtgctgatcaaggtacggctgaccgatgccagcggcatacccgtcaccggccgcatg
caggtcacactggaagccgaccgcggtcgctggcttgagaacgacctcaacccgagtgag
cctggcgcccaagtcttcatcgaaggcggcgttgccgagttccgcctgctgccgcccggc
gagcccggtgatatgcgggtgcgcgtgtcggcaggcactttcgttaaagaagcccgcgtg
gccttgctgcctgagttgcgccccatgatcggcgtcggcatcattgaaggaacgctcgac
ttcaccaaacgcagcgcgctcacgttgggccagatgcctgccggcgctgcttttgaaacc
gagctctccggtttcgcgtctgatggcacctccagttcacgcggtgccgcgcgcagcgct
ttcttctttaaaggtgcggtccaaggcgactacctgctgacagccgcttacgactctgac
aaaaccaccaaggaccgcctctttcgcgacatccgtccggacgagttctatcccgtttac
ggcgactcttcggtgcgcggctttgacgcgcaaagcacgcaaaaattctatgtgcggatc
gataaaaaccgctcatacctcttgtatggcgacttcaccacggccagcagttctgaagtc
cgtcagatgagccagtccagccgcacgctgaccggcattaaaaatgtgtacgaaagcgac
accgtgcgtgccaccagctatgcttcgcgcacggcgcaaacccagcgtatcgaagaattt
cccgcgcttggtatttcggggccctaccacctcaatgctggcaatggcgacctgcttgcc
aacagtgaaaagattgaaattctggtgcgtgaccgcaaccagcccaacatcgtattgcag
accacgtcggttgcgcgttttaccgactacaccattgagccgctgaccagtcgcttgctg
ttcacccgtccgattgcttcagttgatacgaatctcaacccgcagtccatccgggtcact
tatgaagttgacagcggcggggcgaagttcaccgtggccggcaccgatgttcaggtcaag
ctgggtgaaaagctgcaggtcggcatggtcgccagcaccgatgaaaaccctgaaaacaaa
cgcaagctgggcgccctgaccgccatcgcccatattgctgagtcaaccacggttgccgcc
gaactggtgcgcaccgaaacggacctgaaaggcactggaagcgctggccgaattgaagtg
cgccaccacgacgaaaaactgggtgccgtggcacaaatcgccaaaaccagcgccagcttc
gacaatcccggctcagccttcagcgccggccgcaccgaggccgtggcccgtgcgcaatac
aagttggacgacaccacgcaggtacgcggcgaagccatctacagcaaggacgcgctgacc
accggtgaccgcaagggcgttgccgtgggtgtgcagaagaaactcagcgagaccctgttg
ggtgaggtcggtgtacgtcacggtgaaaactccagccccaccgcatcgatgtttgactac
aaccaggtctccagcagcagcgcgctgggcgctggctcgcttggcaattccgtcaccagc
ctcggcgcttccgccgctgctgctggcaccagcaaccaggacatcacgaccgttcgtggg
cgcctgaccactgtggtgccccatcttcctcaggcccaggtattcgttgaagcggagcag
gacatcaatcacggcgaccgtcatgtgttggccgccggtggcaactacgccatcactgac
aaaacccgcgcctatggacgctatgaattcatttccagcctggacggtccctacagcctg
aacaactcgtccagccgcaacatcggcatcctgggcatcgagagcaactacatggaaggg
ggccgcgtttacaacgaataccgcctggccgattcgctcgatgggcgcaccggccaggcc
gccatgggtgtgcgcaacactttcaagttgaacgagcagtggcgtctgactgctggcatc
gagcgcaccaagtccatcgggagcagcgcctccggcatcgtcggccggggcaactcgaca
gccatcgtcaccggcgcggagtacctgagtgaccgtgtcaaggccagcggcattcttgaa
gcccgtcagggcgatgacagcaatagctatctttcgagcctgggcgtgggttacaagatt
gataccgactggtccttgctggcacgcagcatcatcagcgagagcaagggccaaggcact
aacgccggcaacgaccgtttgctgtcacgccagcaaattggcatcgcctaccgcccggtc
gatcaggacaagtggaacgccctggcccgttatgagcataaaaccgagcgtgtcaacggc
gccggctctgtgctgggcgctgtgaacagcagcagcgttttcggcagcaatgcccccggt
acttacagtgcagacatcgtgtcgtcgcacttcaattacaaccctcaacgcggcacttat
ctcactggccgctacgccggcaaggtgtccagcgctgacgacggctttttgggcagcagc
tactgggcgcatctggtccagggtcgctacacgcgcgatctgtccagggactgggacgtt
ggcttgcaggccggcctgctgtacggcaagggcggtgcgcttcaaaagactgccggtgtt
gagttgggttaccaggtcgccaaagacctgtgggtgtcggctggctataacgtcgttggc
ttgaaagaccgcgacctcaccgccggtgagtacaccagcgagggcgtctatatccgcctg
cgcttcaagtttgatgaaaacattttttcaaccgccttgcccgctgtcactaaataa

DBGET integrated database retrieval system