KEGG   Polaromonas naphthalenivorans: Pnap_0411Help
Entry
Pnap_0411         CDS       T00459                                 

Definition
(GenBank) hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_33 HTH_Tnp_Tc3_2 HTH_23
Motif
Other DBs
NCBI-ProteinID: ABM35734
UniProt: A1VII9
Position
complement(420397..420855)
Genome map
AA seq 152 aa AA seqDB search
MSWRNGQAYAQDLRDRVLAAPGVLREVAERFGVSQAYVCRARARRERLGQTGPGAQHNHM
PLRLAALEGALREQVARAPAQTLRELRQWVRAEHGIEVGTTTMFKTLRRFGLTLKKNHPA
RGRANAARRRPGPPGLERQTTKPAGRSADLPR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcgaaatggacaagcctatgcacaggatttgcgcgaccgggtgctggccgcg
ccaggcgtgctgcgcgaggtcgccgagcgctttggcgtgagccaggcctatgtctgccgg
gcgcgggcacgccgcgagcggctcggccagacgggcccgggcgcgcagcataaccacatg
ccgctgcgcctggccgcgctggagggcgcgctgcgcgagcaggtcgccagagcgccggcg
cagacgctgcgcgagctgcgtcagtgggtgcgtgccgagcacggcatcgaggtaggcacc
accacgatgttcaagaccctgaggcggttcgggctgacgctaaaaaaaaatcaccctgca
cgcggccgagcaaacgcggcccgacgtcgcccaggcccgccaggactggagcgccagaca
accaagcctgccggccgctcggctgatcttcctcgatga

DBGET integrated database retrieval system