KEGG   Polaromonas naphthalenivorans: Pnap_0423Help
Entry
Pnap_0423         CDS       T00459                                 

Definition
(GenBank) IS66 Orf2 family protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TnpB_IS66
Motif
Other DBs
NCBI-ProteinID: ABM35745
UniProt: A1VJB7
Position
complement(439115..439402)
Genome map
AA seq 95 aa AA seqDB search
MRAGTDTALARVVAVFGAAHPHTAYLFANKRANRMKVLVHDGIGIWLAARRLHQGKFIWP
SQNTANCRLGREQLDALVLGLPWQRMGEAGIITIT
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgggcaccgacaccgcgctggcgcgggtggtggccgtctttggcgctgcccac
ccgcataccgcgtatctgttcgccaacaagcgggccaaccgcatgaaggtgctggtccat
gatggaatcggcatctggctggccgcgcgccggctgcaccagggcaagttcatctggcct
tcgcagaacactgccaattgcaggctgggacgcgagcagctcgacgcgctggtgctgggc
ctgccttggcagcgcatgggcgaggcgggcattatcacgatcacctga

DBGET integrated database retrieval system