KEGG   Polaromonas naphthalenivorans: Pnap_0424Help
Entry
Pnap_0424         CDS       T00459                                 

Definition
(GenBank) transposase IS3/IS911 family protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_1 HTH_Tnp_ISL3 TilS
Motif
Other DBs
NCBI-ProteinID: ABM35746
UniProt: A1VJB8
Position
complement(439444..439854)
Genome map
AA seq 136 aa AA seqDB search
MLKNSETSRYSTRRTHRTYTAQFKAELVAACGQLGVSIAALAGQHAMNANVLHRWLKEHH
RSGRHQLAVHSPAAAAAPETASPLVAFIPLQLPAPAQQPETREIKVELRRGALSMVVTWP
VSAAAELASWTAALVK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagaactcagagacttcgagatattcgacacggcgcacccaccgcacctacacg
gcacagttcaaagccgaactggtggccgcctgtgggcagctcggcgtttcgattgccgcc
ttggccgggcagcatgcaatgaacgccaacgtgctgcaccgctggctcaaggagcatcac
cgcagcgggcgtcaccagctggcagtccacagtcctgccgctgctgctgcccctgagaca
gcttctcctcttgtcgcgttcatccccttgcagctgcccgcgcccgcgcagcagcccgaa
acccgggagatcaaggtagagctgcgccggggcgcgctgtcgatggtcgtgacctggccc
gtcagcgcggcagccgagttggcgagctggacggctgcgcttgtcaaatga

DBGET integrated database retrieval system