KEGG   Polaromonas naphthalenivorans: Pnap_0425Help
Entry
Pnap_0425         CDS       T00459                                 

Definition
(GenBank) transposase, IS4 family
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF772 DDE_Tnp_1 DDE_Tnp_1_6 HH_signal FUSC
Motif
Other DBs
NCBI-ProteinID: ABM35747
UniProt: A1VJB9
Position
complement(439931..441178)
Genome map
AA seq 415 aa AA seqDB search
MEPRPRAPQTGELPRPRLDEQLKMSHPLIRLASLMNWEEIERSFGAHFTSSRGRPALRPR
LVAGLLYLQHANDASDKAVVATWLENPYWQYFCGETYLQTELPIDPSSLTRWRKRIGEEG
VEVLLAVTIEAARAAGLIKKSSLNQVIVDTTDSRLLEKSRQHLVKLADEHHLQLRQNYNR
QAPRMAAQIGRYAHARQFKRMRKMLKALRVRVARVYREVMRKLGQLPEQTQSKARDLLHR
VGRILNQRTKDKNKLYALHAPEAECISKGKARTPYEFGVKVSIASTLREGLVVGMRSMPG
NPYDGHTLDETIEQVEILAEKRPGIAIVDKGYRGAQVDGVQILRSGQRRSITRTMKAMIK
RRSDIEPTIGHMKTDGRLARNPLKGELGDALHAVLCGAGHNLRLIINKLKIPCAP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaacccagaccgcgcgcaccccagacgggcgagttgccccgcccccgcctggacgag
cagctcaagatgagccaccccttgattcgcctggccagcctgatgaactgggaggagatc
gaacgcagctttggcgcccacttcacgtcaagccggggacgccctgcattgcgccctcgc
ctggtcgcggggctcctgtatctgcagcatgccaacgacgccagcgataaagcggtggtg
gcgacctggctggaaaacccctactggcaatacttttgcggtgaaacctatctgcagacc
gagctgcccatcgacccctccagcctgacgcgctggcgaaagcgcatcggtgaagaaggc
gttgaggtgttgctcgccgtcaccatcgaggcagcccgcgcagcaggcctgatcaaaaaa
agcagcctgaaccaagtcatcgtcgataccaccgacagccgattgctggagaaaagccgc
caacacctggtcaagctcgccgatgaacaccatttgcaattgcgccagaactacaaccgg
caggcgccgcgcatggccgcgcaaatcggccgctacgcgcatgccaggcaattcaagcgc
atgaggaaaatgctcaaagccctgcgagtccgggtggcccgcgtgtaccgcgaagtcatg
cgcaagttgggccaattgccagagcagacgcagtccaaggcgcgggatctgctgcaccgc
gtgggccgcatcctgaatcaaagaaccaaagacaaaaacaaactgtacgcgctgcacgca
ccggaggcagagtgcatctcgaaaggcaaggccaggacgccctacgagtttggcgtcaag
gtcagcattgccagcaccctcagggaaggcctggtggtcgggatgcgcagcatgccgggc
aatccgtacgacgggcacacgctcgatgaaaccatcgagcaggtcgaaatcctcgccgag
aaaagacccggcattgccatcgtggacaagggttaccggggcgcgcaggtcgacggggtg
cagattctgcgctcaggccagcgccggagcatcacccgaaccatgaaggcgatgatcaag
cggcgaagcgacattgagccaaccatcggccacatgaaaacggacggccggctggcccga
aatccactcaaaggtgagctgggtgacgccttgcatgccgtgttgtgcggcgcaggccat
aaccttcgcctgatcatcaataaactaaaaattccctgtgctccgtaa

DBGET integrated database retrieval system