KEGG   Polaromonas naphthalenivorans: Pnap_0426Help
Entry
Pnap_0426         CDS       T00459                                 

Definition
(GenBank) transposase IS116/IS110/IS902 family protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transposase_20 DEDD_Tnp_IS110 HHH_3 HHH Tmemb_cc2
Motif
Other DBs
NCBI-ProteinID: ABM35748
UniProt: A1VJC0
Position
441484..442551
Genome map
AA seq 355 aa AA seqDB search
MSNITRVGVDLAKNVFQVHAVDASGNVVTNRMLKRDRFLAWCCDLPPGCLVAMEACSGAH
HWCRQLRDRGLDARMIAAQFVAPYRIQGKSGKNDANDAAAICEAASRPHMNFVPPKTLAQ
QGMLCVHRLREGLKQERTACINRIRGLLAEFGIVLPQSPQVLRQHLSDLIEDAGNDIAGM
ARLVLQRAQEHWREIEEHVQWCDQRIAAHQKDDEQVQRAAELKGIGPVTASAVVATVGDF
KQFKNAAQFGAWLGLTPKQNSSGGKSSLSSITKRGSNYLRGLLIQGAKSVVLVGKHNDDP
ISQWAQRLRERCGWQKAVVALANKNARILWAVMTKEKRYDAFHVSIPPSAIAATA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacattacacgagtcggcgttgatttggccaagaatgttttccaggttcacgct
gtggatgccagtggcaacgtggtcactaaccggatgctcaagcgtgaccgatttctggca
tggtgttgcgatctgccgcccggctgcctggtcgcgatggaagcttgcagtggcgcccat
cactggtgtcggcaactccgcgatcgaggcctggacgccaggatgattgcagcccagttc
gttgcgccgtaccgtattcagggcaagagcggcaagaacgatgccaacgatgcagcagcg
atttgcgaggcggcctcaagaccgcacatgaatttcgtgccgcccaagacccttgctcag
caaggcatgctgtgcgtgcatcgcctgcgtgaagggctcaaacaagagcgcactgcctgc
atcaaccgaatccgaggtttgctggccgagtttggcatcgttctgcctcaaagcccacag
gtgctgcgacaacacttgagtgacctgattgaggatgctggcaatgacatcgccggcatg
gcacggctggttctgcaaagagcgcaagagcactggcgagaaatcgaagagcacgtccag
tggtgcgaccagcgcattgccgctcatcagaaggacgatgagcaggtccagcgcgcagca
gagctcaagggcattggacccgtcaccgcctcagcggtcgtggcgacggtgggcgacttc
aagcagttcaagaacgcagcgcagttcggcgcctggctggggctgacaccgaagcaaaac
tccagcggaggcaagtcaagtctgagcagcatcaccaaacggggcagcaattacttgcgc
ggcttgctgattcagggcgccaagtcagtcgttttggttggcaagcacaacgacgatccc
atctcacagtgggcgcagcgccttcgcgagcgatgtgggtggcaaaaagccgtcgtggcc
ttggccaacaagaacgcccggattttgtgggccgtcatgacgaaggaaaagcgctatgac
gcctttcacgtcagcatcccaccttcagccattgccgccacagcgtaa

DBGET integrated database retrieval system