KEGG   Polaromonas naphthalenivorans: Pnap_0429Help
Entry
Pnap_0429         CDS       T00459                                 

Definition
(GenBank) Integrase, catalytic region
  KO
K07497  putative transposase
Organism
pna  Polaromonas naphthalenivorans
Brite
KEGG Orthology (KO) [BR:pna00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Pnap_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_3 HTH_21 DDE_Tnp_IS240
Motif
Other DBs
NCBI-ProteinID: ABM35751
UniProt: A1VJC3
Position
complement(444542..445519)
Genome map
AA seq 325 aa AA seqDB search
MSRQCVLAGISRAALYARRKPKRIVQDDELLLRLIDEEYTRHPFYGSRKMVVHLGRCGHS
VNRKWAQRLMRSLGLAGMAPGPNTSRAHPQHKVYPYLLRGVAISRPNQVWSTDITYIRLA
RGFAYLVAVIDWYSRRVLSWRISNSMETVFCVDCLEEALRIHGKPEVFNTDQGSQFTSEA
FTSVLKREGVIISMDGRGRALDNIFVERLWRSVKHEDVYLKGYSAMGELLIGLTQYFTFY
NGERPHQALKNLTPDVVYQRAQGGGAMIVDKYGAAQSLPMALRSTGTAFDEVRLALLCHV
THADAGLSWRCSEGTERKSRDEAWR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgccaatgcgtcctggcaggcatctcacgcgccgcgctgtacgcgcggcgaaag
cccaagcggatcgttcaggacgatgagttgctcttgcgtctgattgacgaggagtacacc
cgccatccgttttacgggagccgcaagatggtggtgcatctggggcgctgcggccacagc
gtcaaccgcaaatgggcacagcgcctgatgcgctcgctgggcctggcgggcatggcgccc
ggccccaataccagccgggcgcacccgcagcacaaggtgtacccgtacctgctgcgcggc
gtggcgatcagtcggcccaaccaggtctggagcaccgacatcacttacatccggctggcc
cgcggctttgcctatctggtggcggtcatcgactggtactcccggcgggtgttgagctgg
cgcatcagtaacagcatggagacggtgttctgcgtggactgtctggaggaggctttgcgc
attcacggcaagcctgaagtcttcaacaccgaccagggctcgcagttcaccagtgaggcc
ttcaccagtgtgctcaaacgcgagggcgtcatcatcagcatggacggtcgaggtagagcg
ttggacaatatttttgtcgagcggctctggcgcagcgtcaagcacgaggacgtgtacctc
aagggctatagcgcaatgggcgagttactgatcggcttgacgcaatacttcacgttttac
aacggtgaacgcccgcatcaagcgctgaagaatctgacacccgatgtggtgtaccagcgt
gctcaagggggtggcgccatgatcgtggacaaatatggcgccgcacagagcctcccaatg
gcgctgcgctccacaggcactgcgttcgatgaagtccgattagcactactctgccatgtc
actcacgccgacgcaggtctatcgtggcgctgcagtgagggcaccgaacgtaaatcacgg
gatgaagcatggcgatga

DBGET integrated database retrieval system