KEGG   Polaromonas naphthalenivorans: Pnap_0442Help
Entry
Pnap_0442         CDS       T00459                                 

Definition
(GenBank) L-asparaginases, type II
  KO
K05597  glutamin-(asparagin-)ase [EC:3.5.1.38]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00220  Arginine biosynthesis
pna00250  Alanine, aspartate and glutamate metabolism
pna00471  D-Glutamine and D-glutamate metabolism
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pnap_0442
   00220 Arginine biosynthesis
    Pnap_0442
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Pnap_0442
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pnap_0442
Enzymes [BR:pna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.38  glutamin-(asparagin-)ase
     Pnap_0442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase
Motif
Other DBs
NCBI-ProteinID: ABM35764
UniProt: A1VJD6
Position
460542..461681
Genome map
AA seq 379 aa AA seqDB search
MGLASARLAILKSLSTFEKYLMQTQLQLKIAKLVTGLGLAAMASLAMAQAAKPNVVILAT
GGTIAGAGASALNSATYAAAKVPVDKLLAGLPELGNVANVRGEQVAQIASESFNNETLMK
LGKRVSALVKQADVDGIVVTHGTDTLEETAYFLNLVVRTSKPIVVVGSMRPGTALSADGA
LNLFDAVSVAASKDAAGKGVLVTMNDEINSGRDVAKLINIKTEAFKSQWGPLGMVVEGKN
YWFRAPVKLHTAQSEFNIDDFETLAPVEIVYSYGNVSTTAVDAVGKSGVKALIHAGTGNG
SVAAALVPSLQAIRAQGVQVIRSSRVPAGFVLRNAEQPDDKYDWVVAHDLNPQKARILAA
VALTKTTDSKELQRIFWQY
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggccttgcatcagctcgtctggcaatcctgaaatccctatcaacctttgagaaatac
ctcatgcaaacgcaactgcaactgaaaatcgcaaaactcgtgaccggcctgggactggcc
gccatggcttccctggccatggcgcaggccgccaagcccaatgtggtgatcctggccacc
ggcggcacgattgccggcgctggcgcttcggccctgaacagcgcgacctacgcggcggcc
aaggtgccggtggacaagctgctggcgggcttgcccgaactgggcaacgtggccaatgtg
cgcggcgagcaggtggcgcagatcgcctccgaaagcttcaacaacgaaaccctgatgaag
ctcggcaagcgcgtctcggccctcgtcaagcaggccgatgtggacggcatcgtggtgacc
cacggcaccgacacgctcgaagaaaccgcctacttcctgaacctcgtggtccgcaccagc
aagcccatcgtggtggtcggctcgatgcgtcccggcacggcgctgtccgccgatggcgcg
ctgaacctgttcgacgcggtgagcgtggccgccagcaaggacgcagcgggcaagggcgtt
ctggtcacgatgaacgacgagatcaacagcggccgcgacgtggccaagctgatcaacatc
aagaccgaagccttcaaaagccagtggggtccgctgggcatggtggtcgaaggcaaaaac
tactggttccgcgcgccggtcaagctccacaccgcccagtccgagttcaatatcgacgat
ttcgaaacgctggcgccggtcgagatcgtgtacagctacggcaatgtgtccaccaccgcc
gtggacgccgtgggcaaatccggcgtcaaggcgctgatccatgccggcaccggcaacggc
tcggtggccgccgccctggtaccgtcgctgcaagccatccgcgcccagggcgtgcaggtg
atccgctcgtcccgcgtgcccgccggctttgtgctgcgcaacgccgagcagcccgacgac
aagtacgactgggtggtcgcgcatgacctgaacccgcaaaaagcccgcatcctggccgcc
gtggcattgaccaaaaccaccgacagcaaggagctgcagcggattttctggcagtattga

DBGET integrated database retrieval system