KEGG   Polaromonas naphthalenivorans: Pnap_0445Help
Entry
Pnap_0445         CDS       T00459                                 

Definition
(GenBank) hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM35767
UniProt: A1VJD9
Position
464914..465564
Genome map
AA seq 216 aa AA seqDB search
MTRPDTGLSPAAAAPSGWTSQRTAWLLFGPPAFMVAVRWLLQLADDRQNATPALSLAPVS
TTTGILDLLWPVAVVLAVLVAVGLVIRRLGWRRVMPVIGGAWLLLWLAGSGAMLERHLNR
QGLFLQGMNASATAPVTPVSARVVTSQFKPPSLRSLGGTELVLQVAGLEIPQRLLIDDAR
AAPLKPGDTLALQLAPGRFSGLFVTGWQASPATDSH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcccggacaccggactttcccctgcagcggcggcgccttccggctggacctcg
cagcgcaccgcctggctgctgttcggcccgcccgccttcatggtcgcggtgcgctggctg
ctgcaactggccgacgaccgccagaacgcgacgccggccctttcgctggcgccggtttcg
accacgaccggcatcctcgacctgctctggccggtggcggtggtgctggccgtgctggtc
gccgtggggctggtgattcgccgactgggctggcgccgtgtcatgccggtgatcggcggc
gcatggctgctgctctggctggccggcagcggcgcgatgctggagcggcacctgaaccgg
caggggcttttcttgcagggcatgaacgcatcggccaccgcacccgtgacgcccgtgagc
gcccgcgtggtcaccagccagttcaagccgcccagcctgcgcagcctgggtggcactgag
ttggtgctgcaggtcgcaggccttgaaattccgcagcgcctgctgatcgacgatgccagg
gctgcgcccctcaagcccggcgacaccttggcgctgcaactcgcccccggccgtttcagc
ggcctgttcgtcaccggctggcaggcgtcgccagccaccgattcccattga

DBGET integrated database retrieval system