KEGG   Polaromonas naphthalenivorans: Pnap_0452Help
Entry
Pnap_0452         CDS       T00459                                 

Definition
(GenBank) PAS/PAC sensor signal transduction histidine kinase
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c PAS PAS_8 PAS_4 PAS_9 HisKA KxDL HATPase_c_2 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: ABM35774
UniProt: A1VJE6
Position
472986..474545
Genome map
AA seq 519 aa AA seqDB search
MSRFLDKFRLTPAGNLPDVSLQSANSSLPAAQPEWGPLDLTLDGIVLLDDKAVILDANAP
ALEFLHTSLSAISGYSLWDVVPEEVAKQNEEATELALDSADRHSFIAHESFENSWVEYTF
RRCPAGYVVNLREAGPAQKYQRLLEDSKRYNQLIFEANPNVMWVFDRTTLRIFAVNQAAV
KFYGIARKIFMTLGMEALFPQGEGAELLRSLHTGKEEQSEMRLCKQKKMDGKEVLVELAW
SQVKWDGHQAVLVSLADISDRHLADGVLKKTNEELQKTLVAQQVELKNVRHDLLTFTQAV
SSDLQDSLHAAHGFAARLAEKYSLALDDQGRHYVRRIQASISQLAKLVDDLRTLAQLPLR
SGVPAMVNLAPVCLSLIADLRKRDPDRDVTIEMDSKLMLVGNKGLLTTAMTCLLENAWKF
TSKKTEAWIKVGLLPGKAPGELVLLVADNGAGFDPVYSGNLFTAFQRLHSSADFPGNGLG
LAIIKRVAQVHGGTVWAESPGQGGASFFMSLPQGEASAS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagccgatttctggacaagttccggttgacccccgcaggtaacttgcccgacgtgagc
ttgcagagcgccaattccagcctgccggcagcgcagccagaatggggacccctggacctg
accctcgatggcatcgtgcttcttgacgacaaagccgtcatccttgacgccaatgctccg
gcgcttgagttcctgcacacctcgctgtccgccatcagcggctacagcttgtgggacgtg
gtgcccgaggaagttgccaagcagaatgaagaggccaccgaactggctctggattctgcg
gaccggcatagctttattgcccatgagagttttgaaaacagttgggtcgaatacaccttc
aggcgatgcccggcaggttacgtcgtcaacctgcgcgaagcgggtccggcccaaaaatac
cagcgcctgctggaagacagcaaacgctacaaccagctgatttttgaagccaatccgaat
gtcatgtgggtctttgaccggaccacgcttcgaatctttgccgtcaaccaggctgccgtc
aagttttacggcattgcccgcaagattttcatgacgcttggcatggaagcgctctttccc
cagggagaaggcgccgaactgctgcgctccctgcacaccggcaaggaagagcagtctgaa
atgcggctgtgcaaacagaaaaaaatggacggcaaggaagtgctggttgagctggcctgg
agccaggtcaagtgggatggccatcaggcggtgctggtgagcctggccgacatcagtgac
cggcacctcgctgacggcgtcctgaaaaaaaccaatgaggaattgcaaaagacactcgtc
gcccagcaggtcgaactgaaaaatgtccggcatgacctgctcacctttacccaggccgtc
tccagtgacttgcaggactccctgcatgcggcccatggctttgccgccaggctggctgaa
aagtattcgctggcgctggacgaccagggccgccactatgtcaggcgcattcaggccagc
atcagccagttggccaagctggtcgatgacctgcgaacactcgcccagctgccgctgcgc
tccggagttcctgcaatggtcaatctggcaccggtctgcctttcattgatcgctgatttg
cgcaagcgcgacccggaccgggatgtgaccatcgaaatggacagcaagctgatgctggtc
gggaacaaggggcttttgacgacagccatgacctgcctgctggaaaatgcctggaaattc
acctccaaaaagaccgaggcatggatcaaggtcgggctgctgcccggcaaggcgccgggt
gagctggtgttgctggtggccgataatggcgccggatttgatccggtttacagcggcaat
cttttcaccgcgtttcagcgcctgcactcttcagccgactttccgggcaacgggctgggg
ctggccatcatcaagcgggttgcgcaggtgcatggcggcacggtatgggctgaaagtccg
ggccaggggggggccagttttttcatgtcgcttccgcaaggggaagccagcgcttcctga

DBGET integrated database retrieval system