KEGG   Polaromonas naphthalenivorans: Pnap_0456Help
Entry
Pnap_0456         CDS       T00459                                 

Definition
(GenBank) Carbonate dehydratase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Pnap_0456
Enzymes [BR:pna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     Pnap_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-ProteinID: ABM35778
UniProt: A1VJF0
Position
476964..477623
Genome map
AA seq 219 aa AA seqDB search
MIFMTTSLQHLLDNNCCWAARMEQQRPDFFSRLVDQQTPKYLWIGCSDSRVPANEIIALD
PGEVFVHRNIANVVVHSDLNALSVIQYAVDHLKVEHIMVVGHYGCGGVLAALRGTRVGLA
DNWLRHVYDVKLRHRQRLDHLPVAEQEDALCEMNVIEQVGNVAMSNVMQDAWSRGQKVEV
HGWCYGLKDGLVKDMEVSMRGADEVVDVFRHALKRYPRG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcatgactacatcgcttcaacacttacttgacaacaactgctgctgggccgct
cgcatggagcagcagcgccctgattttttcagccggctggtggatcagcagacgcccaaa
tacctgtggataggctgctcggacagccgggtgccggccaatgaaatcatcgcgcttgat
ccgggggaagtgtttgtacaccgcaatattgcaaacgtggtggtgcattcggacctcaat
gccctgtcggtgatccagtacgccgtggatcatctcaaggtggagcacatcatggtggtg
gggcattacggttgcggtggcgtgctggccgcgctgcgcggcacccgcgtcggtctggct
gacaactggctgcgccatgtctatgacgtcaagctgcgccaccggcaacgcctggaccat
ttgccggtggccgagcaggaggatgcgctgtgcgagatgaacgtgatcgagcaggtgggc
aacgtggccatgtccaatgtgatgcaggacgcctggagccgggggcagaaagtggaagtc
cacggctggtgctatggcctcaaggatggcctggtaaaagacatggaggtcagcatgcgg
ggcgctgatgaagtggtggacgtttttcgccatgcgctcaaacgctaccctcgcggctga

DBGET integrated database retrieval system