KEGG   Polaromonas naphthalenivorans: Pnap_1843Help
Entry
Pnap_1843         CDS       T00459                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00071  Fatty acid degradation
pna00072  Synthesis and degradation of ketone bodies
pna00280  Valine, leucine and isoleucine degradation
pna00310  Lysine degradation
pna00362  Benzoate degradation
pna00380  Tryptophan metabolism
pna00620  Pyruvate metabolism
pna00630  Glyoxylate and dicarboxylate metabolism
pna00640  Propanoate metabolism
pna00650  Butanoate metabolism
pna00900  Terpenoid backbone biosynthesis
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
pna01130  Biosynthesis of antibiotics
pna01200  Carbon metabolism
pna01212  Fatty acid metabolism
pna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pnap_1843
   00630 Glyoxylate and dicarboxylate metabolism
    Pnap_1843
   00640 Propanoate metabolism
    Pnap_1843
   00650 Butanoate metabolism
    Pnap_1843
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pnap_1843
   00072 Synthesis and degradation of ketone bodies
    Pnap_1843
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pnap_1843
   00310 Lysine degradation
    Pnap_1843
   00380 Tryptophan metabolism
    Pnap_1843
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pnap_1843
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pnap_1843
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pnap_1843
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pna04147]
    Pnap_1843
Enzymes [BR:pna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pnap_1843
Exosome [BR:pna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pnap_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABM37153
UniProt: A1VNC5
Position
1964964..1966139
Genome map
AA seq 391 aa AA seqDB search
MTSAVIVSTARTPLAKSWKGAFNMTHGATLGGHAVQHAMARAGIDAAEVDDVIIGCATPE
GATGANIARQIALRAGCPVSVSGMTVNRFCSSGLQAIALASQRIIAGEADIYVAGGVESI
SCVQQEMNTHMLREDWLAKNKPEIYWNMLQTAEQVAKRYEISRERMDDYGAASQQKATAA
LAAGLFEAEIAPITVTMGVADPVMGLMTKQVTVSQDEGIRAGTTKEGISGLRSAIPGGLI
SAGNASQFSDGGGAVVVMDEKVAERKGLKPLGRFLGFAVAGCEPDEMGIGPVFAIPKVLA
KLGLSVSDIDLWELNEAFAVQVLYCADKLGIPMDRLNVNGGAIAVGHPYGVTGQRLTGHA
LIEGKRRGARRVCVTMCIGGGMGAAGVFEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagctgtaatcgtttccaccgcccgcacccctctggccaagagctggaagggc
gccttcaacatgacgcacggcgccaccctgggcggccatgccgtgcagcacgccatggcc
agagccggcatcgacgccgccgaagtcgatgacgtcatcatcggctgcgccacgcccgaa
ggcgcgaccggcgccaacatcgcgcggcagatcgccctgcgcgccggttgcccggtcagc
gtctcgggcatgaccgtgaaccgcttttgctcgtccggcctgcaggcgattgcgctggcg
tcgcagcgcatcattgccggcgaagccgatatctacgtcgccggcggcgtcgaaagcatt
tcctgcgtgcagcaggagatgaacacccacatgctgcgcgaggactggctcgccaagaac
aagcccgagatttactggaacatgctgcaaaccgccgagcaggtcgccaagcgctacgaa
atcagccgagaacgcatggacgactacggcgcggccagccagcaaaaagccaccgccgcg
ctggctgccggcctgttcgaggccgagatcgcaccgatcaccgtcaccatgggcgtcgcc
gatccggtgatgggcttgatgaccaaacaggtcacggtcagccaggacgagggcattcgc
gccggaacgacgaaggaaggcatcagcggcctgcgctcggcgattccgggcggcctgatc
tcggccggcaatgccagccagttttcggacggcggcggcgcggtcgtggtgatggacgaa
aaagtcgcagagcgcaaaggcctcaagccgctgggacgcttcctgggttttgccgtggcc
ggctgcgagcccgatgaaatgggcatcggcccggtgtttgccattcccaaggtgctcgcc
aagctgggcctgagcgtcagtgacatcgacctgtgggaactcaacgaagcgtttgccgtg
caggtgctgtactgcgccgacaagctgggcattcccatggaccggctcaacgtcaatggc
ggcgcgattgccgtcggccacccctacggcgtcaccggccagcgcctgaccggccacgcg
ctgatcgaaggcaagcggcgcggcgccaggcgcgtttgcgtgacgatgtgcataggcggc
ggcatgggcgctgcgggcgtgttcgaggtgttgtga

DBGET integrated database retrieval system