KEGG   Polaromonas naphthalenivorans: Pnap_2893Help
Entry
Pnap_2893         CDS       T00459                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pna00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pnap_2893
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pna01007]
    Pnap_2893
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pna03016]
    Pnap_2893
Enzymes [BR:pna01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Pnap_2893
Amino acid related enzymes [BR:pna01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Pnap_2893
Transfer RNA biogenesis [BR:pna03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Pnap_2893
 Prokaryotic type
    Pnap_2893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ABM38192
UniProt: A1VRB4
Position
complement(3043914..3045305)
Genome map
AA seq 463 aa AA seqDB search
MSLRIYNTLSRAVEDFSPLVPGQVRMYVCGMTIYDLCHIGHARMMMAFDVVQRWLKASGY
EVRYVRNITDIDDKIIKRAVERGITIRALTDEMIAAMHQDIGALGIEPPTLEPRATEYVP
QMLAMIGKLEEKGLAYRGSSGDMNYAVRKFPGYGKLSGKSLDELRAGERVAVLEGKDDPL
DFVLWKSAKESEPEDAKWDSAALGHDYGKGRPGWHIECSAMSCQTLGETFDIHGGGADLQ
FPHHENEIAQSEGANGKPLARFWVHNGFVRVDNEKMSKSLGNFFTIRDVLQKYDAETIRF
FIIRAHYRSALNYSDAHLDDARNSLKRLYTALALVAPATVEIDWADPFAARFKAAMDEDF
GTPEAIAVLFELAGEVNKTHSAERAGLLKSLGACLGLLQGEPSAYLQAGAGLDDAAIQAL
ITQRADAKKARDFAAADRIRTELLGQGIVLKDSPLGTTWEVQS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagccttcgtatttacaacacgctgtcgcgtgccgtagaggatttttctccccttgtt
cccggccaggtccgcatgtatgtgtgcggcatgaccatttatgacctttgccacatcggc
catgcgcgcatgatgatggctttcgatgtggtgcagcgctggctcaaggccagcggctac
gaggtcaggtatgtgcgcaacatcaccgacatcgacgacaagattatcaagcgcgcggtc
gagcgcggcatcaccatccgcgcgctgaccgacgagatgatcgcggccatgcaccaggac
atcggcgcgctgggcatcgagccgccgacgctggagccgcgcgcgaccgaatacgtgccg
cagatgctggcgatgatcggcaagctcgaagaaaaagggctggcctaccggggctctagc
ggcgacatgaactacgccgtgcgcaagttcccgggttacggcaagctgtcgggcaagtcg
ctcgacgagttgcgcgccggcgagcgcgtcgccgtgctcgaaggcaaggacgacccgctg
gacttcgtgctgtggaagtcggccaaggagagcgagcccgaggacgccaagtgggacagc
gcggcgctgggccacgactacggcaagggccggcccggctggcacatcgaatgctcggcc
atgagctgccagacgctgggcgagaccttcgacatccacggcggcggggccgacctgcag
tttccgcaccacgaaaacgagattgcccagagcgaaggcgccaacggcaagccgctggcg
cgattctgggtgcacaacggcttcgtgcgcgtggacaacgagaagatgtccaagtcgctg
ggcaacttcttcaccatccgcgacgtgctgcaaaagtacgacgccgaaaccatccggttt
ttcatcatccgcgcgcactaccgcagcgcgctgaactacagcgatgcgcacctcgacgat
gcgcgcaattcgctcaagcgcctgtacacggcgctggctctggttgcgccggccaccgtg
gaaatcgactgggccgacccgttcgcagcccgcttcaaggccgcgatggacgaggacttc
ggcacgcccgaagccattgccgtgctgttcgagctggccggcgaggtcaacaagacgcat
tccgccgaacgcgccggactgctgaaaagcctgggcgcctgcctgggcctgctgcagggc
gagccttcggcttatctgcaggcgggtgcggggctggacgatgcagccatccaggcattg
atcacgcagcgcgccgacgccaagaaggccagggactttgcggcggcagaccgaatccgc
accgaactgctgggccaaggcatcgtgctcaaagactcgcctctgggaacgacctgggag
gtgcagtcgtga

DBGET integrated database retrieval system