KEGG   Polaromonas naphthalenivorans: Pnap_3046Help
Entry
Pnap_3046         CDS       T00459                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00260  Glycine, serine and threonine metabolism
pna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01130  Biosynthesis of antibiotics
pna01230  Biosynthesis of amino acids
Module
pna_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnap_3046
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnap_3046
Enzymes [BR:pna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnap_3046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABM38345
UniProt: A1VRR7
Position
3218969..3220273
Genome map
AA seq 434 aa AA seqDB search
MYDYHQPDLAGHFGIYGGSFVSETLTHAINELKDAYARYQNDPKFLAEFNYELKHFVGRP
SPIYHAARMSREQGGAQIYLKREDLNHTGAHKINNTIGQAMLARRMGKQRIIAETGAGQH
GVATATICARYGLECVVYMGSEDVKRQSPNVYRMNLLGATVVPVESGSKTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLSQMPEMNAGRQPDAVVACVGGG
SNAMGIFHPYIAHENTRLIGVEAAGEGLDSGKHSASLQRGLPGVLHGNRTYVLQNDDGQV
TETHSISAGLDYPGVGPEHAYLKDIGRAEYVGITDTEALQAFHYLCRTEGIIPALESAHA
VAYAMKLAKTMRSDQSILVNLSGRGDKDIGTVADLSGADFYDRPSMRGLGVKGGVATSPE
SFDASGAKGAGSQS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatcaccaacctgacctggccggtcatttcggcatttacggcggcagtttc
gtctccgaaaccctgacccacgcgatcaatgagctgaaggacgcctacgccaggtaccag
aacgacccgaaattcctggccgaattcaactacgagctgaagcatttcgtcggccgccct
tcccccatctaccatgccgcgcgcatgagccgcgaacagggcggcgcgcagatctacctc
aagcgcgaagacctgaaccacaccggcgcgcacaagatcaacaacaccatcggccaggcc
atgctggcccgccgcatgggcaagcagcgcatcattgcagagaccggcgcgggccagcac
ggcgtggccaccgccacgatttgcgcccgctacggccttgaatgcgtggtctacatgggc
agcgaggatgtcaagcgccagagccccaatgtttaccgcatgaacctgctgggcgccacc
gtggtgccagtggaaagcggcagcaagacgctgaaagatgcgctcaacgaagccatgcgc
gactgggttgccaatgttgacaacacgttttacatcatcggaaccgtggccggaccgcac
ccctacccgatgatggtgcgcgacttccagagcgtgatcggcaccgaatgcctgagccag
atgcccgagatgaacgctggcaggcagcccgatgcggtcgttgcctgtgttggcggcggc
agcaatgccatgggcatcttccacccttatatcgcgcatgaaaacacccgcctgatcggc
gtcgaagccgccggagaagggctggacagcggcaagcattcagcttcgctgcagcgcggc
ctgcccggcgtgctgcatggcaaccgcacctatgtgctgcaaaacgacgatggccaggtg
accgagacgcacagcatcagcgccggactggactaccccggcgtcggcccggagcacgcc
tacctgaaagacatcgggcgcgccgaatatgtcggcatcaccgacaccgaagcgctgcag
gcttttcattacctgtgccgcaccgaaggcatcattccggcactggaatccgcccatgcc
gtggcctacgcgatgaagctggccaaaaccatgcgcagcgaccagagcatcctcgtcaac
ctctcgggccggggcgacaaggacattggcaccgtggccgatctgtcgggtgctgacttc
tatgaccggccttccatgcgcggcctgggcgtcaagggtggcgttgccacttcccccgaa
tcattcgacgccagcggcgcaaaaggtgcagggagccagtcatga

DBGET integrated database retrieval system